StarFunc result for job id P13284

User Input

>input (250 residues)
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAP
LVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHG
EEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAM
GDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSS
TSSLRSVCFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7N7	0.785	0.785	5.561E-47	250	1.000	1.000	A0A024R7N7.pdb.gz
2	AFDB:Q9ESY9	0.743	0.749	4.481E-34	248	0.612	0.617	Q9ESY9.pdb.gz	GILT_MOUSE Gamma-interferon-inducible lysosomal thiol reductase OS=Mus musculus OX=10090 GN=Ifi30 PE=1 SV=3
3	AFDB:E7E2N8	0.701	0.698	1.275E-23	251	0.384	0.382	E7E2N8.pdb.gz	GILT_CARAU Gamma-interferon-inducible lysosomal thiol reductase OS=Carassius auratus OX=7957 GN=ifi30 PE=1 SV=1
4	AFDB:Q5XJN2	0.706	0.692	1.523E-23	255	0.368	0.361	Q5XJN2.pdb.gz	GILT_DANRE Gamma-interferon-inducible lysosomal thiol reductase OS=Danio rerio OX=7955 GN=ifi30 PE=1 SV=1
5	AFDB:M9WEU5	0.695	0.687	4.785E-22	253	0.348	0.344	M9WEU5.pdb.gz	M9WEU5_ONCMY Interferon-gamma-inducible-lysosomal thiol OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
6	AFDB:Q93VQ6	0.639	0.605	1.206E-15	265	0.284	0.268	Q93VQ6.pdb.gz	Q93VQ6_ARATH At1g07080/F10K1_15 OS=Arabidopsis thaliana OX=3702 GN=At1g07080 PE=1 SV=1
7	AFDB:O17861	0.623	0.565	1.225E-14	277	0.244	0.220	O17861.pdb.gz	YVRI_CAEEL GILT-like protein F37H8.5 OS=Caenorhabditis elegans OX=6239 GN=F37H8.5 PE=1 SV=1
8	AFDB:Q95RA9	0.660	0.660	3.219E-13	250	0.208	0.208	Q95RA9.pdb.gz	GILT1_DROME GILT-like protein 1 OS=Drosophila melanogaster OX=7227 GN=GILT1 PE=1 SV=1
9	AFDB:Q9VCK1	0.550	0.654	1.915E-12	207	0.228	0.275	Q9VCK1.pdb.gz	GILT2_DROME GILT-like protein 2 OS=Drosophila melanogaster OX=7227 GN=GILT2 PE=2 SV=1
10	PDB:4zilA	0.423	0.490	8.286E-5	210	0.096	0.114	4zilA.pdb.gz
11	AFDB:Q73GA4	0.401	0.424	8.496E-4	234	0.140	0.150	Q73GA4.pdb.gz	Q73GA4_WOLPM Thioredoxin-like fold domain-containing protein OS=Wolbachia pipientis wMel OX=163164 GN=WD_1055 PE=1 SV=1
12	PDB:3rpnA	0.456	0.509	2.603E-3	220	0.096	0.109	3rpnA.pdb.gz	Crystal structures and kinetic studies of human Kappa class glutathione transferase provide insights into the catalytic mechanism.
13	PDB:1r4wA	0.455	0.507	2.931E-3	221	0.092	0.104	1r4wA.pdb.gz	Parallel Evolutionary Pathways for Glutathione Transferases: Structure and Mechanism of the Mitochondrial Class Kappa Enzyme rGSTK1-1
14	PDB:2h0hB	0.312	0.334	3.301E-3	230	0.112	0.122	2h0hB.pdb.gz
15	PDB:3f4tA	0.388	0.468	1.295E-2	200	0.084	0.105	3f4tA.pdb.gz
16	PDB:2ndoA	0.355	0.450	1.964E-2	189	0.104	0.138	2ndoA.pdb.gz	Determination of ligand binding modes in weak protein-ligand complexes using sparse NMR data.
17	PDB:2imdA	0.440	0.528	4.007E-2	203	0.076	0.094	2imdA.pdb.gz	2-Hydroxychromene-2-carboxylic Acid Isomerase: A Kappa Class Glutathione Transferase from Pseudomonas putida
18	PDB:2d2zB	0.121	0.125	1.168E-1	240	0.148	0.154	2d2zB.pdb.gz
19	PDB:2qc7A	0.152	0.168	2.684E-1	224	0.044	0.049	2qc7A.pdb.gz
20	PDB:2r5gA	0.120	0.124	3.613E-1	237	0.116	0.122	2r5gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13284	0.0	513	250	1.000	1.000	GILT_HUMAN Gamma-interferon-inducible lysosomal thiol reductase OS=Homo sapiens OX=9606 GN=IFI30 PE=1 SV=3
2	Q9ESY9	1.06e-98	290	248	0.532	0.536	GILT_MOUSE Gamma-interferon-inducible lysosomal thiol reductase OS=Mus musculus OX=10090 GN=Ifi30 PE=1 SV=3
3	Q5XJN2	1.08e-60	193	255	0.360	0.353	GILT_DANRE Gamma-interferon-inducible lysosomal thiol reductase OS=Danio rerio OX=7955 GN=ifi30 PE=1 SV=1
4	E7E2N8	5.60e-60	191	251	0.360	0.359	GILT_CARAU Gamma-interferon-inducible lysosomal thiol reductase OS=Carassius auratus OX=7957 GN=ifi30 PE=1 SV=1
5	M9WEU5	3.02e-55	179	253	0.348	0.344	M9WEU5_ONCMY Interferon-gamma-inducible-lysosomal thiol OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
6	Q93VQ6	4.51e-27	107	265	0.280	0.264	Q93VQ6_ARATH At1g07080/F10K1_15 OS=Arabidopsis thaliana OX=3702 GN=At1g07080 PE=1 SV=1
7	O17861	1.31e-23	98.2	277	0.252	0.227	YVRI_CAEEL GILT-like protein F37H8.5 OS=Caenorhabditis elegans OX=6239 GN=F37H8.5 PE=1 SV=1
8	Q9VCK1	1.23e-12	67.0	207	0.168	0.203	GILT2_DROME GILT-like protein 2 OS=Drosophila melanogaster OX=7227 GN=GILT2 PE=2 SV=1
9	Q95RA9	8.08e-12	65.5	250	0.212	0.212	GILT1_DROME GILT-like protein 1 OS=Drosophila melanogaster OX=7227 GN=GILT1 PE=1 SV=1
10	O88575	3.3	31.6	635	0.072	0.028	S620B_MOUSE Sodium- and chloride-dependent transporter XTRP3B OS=Mus musculus OX=10090 GN=Slc6a20b PE=1 SV=3
11	Q0E8P6	3.9	31.6	4236	0.076	0.004	Q0E8P6_DROME Beethoven OS=Drosophila melanogaster OX=7227 GN=btv PE=3 SV=3
12	Q9UIR0	6.3	30.4	455	0.160	0.088	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03227 GILT	2.8e-25	100.0	Gamma interferon inducible lysosomal thiol reductase (GILT)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262629	0.741	TYRO protein tyrosine kinase-binding protein
2	9606.ENSP00000259254	0.720	Glycophorin-C
3	9606.ENSP00000231368	0.678	Leucyl-cystinyl aminopeptidase
4	9606.ENSP00000341684	0.677	Coiled-coil domain containing 15
5	9606.ENSP00000265807	0.665	SH2 domain-containing protein 4A
6	9606.ENSP00000363976	0.660	HLA class II histocompatibility antigen, DM alpha chain
7	9606.ENSP00000365233	0.657	Tripeptidyl-peptidase 2
8	9606.ENSP00000312002	0.640	Hepatitis A virus cellular receptor 2
9	9606.ENSP00000304467	0.639	Thimet oligopeptidase
10	9606.ENSP00000251900	0.631	Sex comb on midleg-like protein 2
11	9606.ENSP00000261714	0.631	Bleomycin hydrolase
12	9606.ENSP00000289902	0.629	High affinity immunoglobulin epsilon receptor subunit gamma
13	9606.ENSP00000363641	0.622	Thioredoxin
14	9606.ENSP00000362993	0.607	Protein bicaudal C homolog 1
15	9606.ENSP00000380855	0.600	Programmed cell death 1 ligand 2
16	9606.ENSP00000395590	0.590	Interferon-induced 35 kDa protein
17	9606.ENSP00000357981	0.579	Cathepsin S
18	9606.ENSP00000227266	0.576	Dipeptidyl peptidase 1
19	9606.ENSP00000227880	0.576	Solute carrier family 15 member 3
20	9606.ENSP00000380948	0.573	Integrin beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015036	1.000	disulfide oxidoreductase activity
GO:0005515	0.997	protein binding
GO:0140096	0.796	catalytic activity, acting on a protein
GO:0015035	0.719	protein-disulfide reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0002376	0.994	immune system process
GO:0048002	0.984	antigen processing and presentation of peptide antigen
GO:0019886	0.971	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0065007	0.721	biological regulation
GO:0050789	0.688	regulation of biological process
GO:0050794	0.413	regulation of cellular process
GO:0050896	0.347	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005829	0.995	cytosol
GO:0005576	0.981	extracellular region
GO:0030054	0.910	cell junction
GO:0005764	0.838	lysosome
GO:0005775	0.511	vacuolar lumen
GO:0016020	0.462	membrane
GO:0043202	0.410	lysosomal lumen
GO:0031981	0.378	nuclear lumen
GO:0005615	0.369	extracellular space
GO:0012505	0.312	endomembrane system
GO:0005654	0.305	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	1.000	Acting on a sulfur group of donors.

[back to server]