StarFunc result for job id P13385

User Input

>input (188 residues)
MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI
CLSIQSYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13385	1.000	1.000	4.095E-37	188	1.000	1.000	P13385.pdb.gz	TDGF1_HUMAN Protein Cripto OS=Homo sapiens OX=9606 GN=CRIPTO PE=1 SV=1
2	AFDB:P51865	0.330	0.351	1.751E-21	171	0.622	0.684	P51865.pdb.gz	TDGF1_MOUSE Teratocarcinoma-derived growth factor OS=Mus musculus OX=10090 GN=Cripto PE=1 SV=2
3	AFDB:Q91649	0.254	0.252	1.238E-11	190	0.293	0.289	Q91649.pdb.gz	Q91649_XENLA Fibroblast growth factor receptor ligand 1 OS=Xenopus laevis OX=8355 GN=cripto1.3.L PE=2 SV=1
4	AFDB:P0CG37	0.220	0.193	4.719E-11	223	0.250	0.211	P0CG37.pdb.gz	CFC1_HUMAN Cryptic protein OS=Homo sapiens OX=9606 GN=CFC1 PE=1 SV=1
5	AFDB:F1Q691	0.264	0.259	1.126E-10	190	0.282	0.279	F1Q691.pdb.gz	F1Q691_DANRE Cryptic protein isoform 1 precursor OS=Danio rerio OX=7955 GN=cb85 PE=3 SV=1
6	AFDB:F1LV65	0.210	0.235	1.204E-10	164	0.271	0.311	F1LV65.pdb.gz	F1LV65_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=4
7	AFDB:P97766	0.215	0.203	3.511E-10	202	0.282	0.262	P97766.pdb.gz	CFC1_MOUSE Cryptic protein OS=Mus musculus OX=10090 GN=Cfc1 PE=1 SV=1
8	AFDB:A0A2R8QT22	0.150	0.033	8.185E-2	1216	0.090	0.014	A0A2R8QT22.pdb.gz
9	AFDB:Q6R8J2	0.186	0.050	8.752E-2	977	0.138	0.027	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
10	AFDB:Q4WXW8	0.137	0.101	9.099E-1	267	0.133	0.094	Q4WXW8.pdb.gz	Q4WXW8_ASPFU Cell wall protein, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G10960 PE=4 SV=1
11	PDB:7nxdB	0.167	0.059	1.288	690	0.080	0.022	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
12	PDB:7nycD	0.151	0.063	1.377	487	0.090	0.035	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:4e0sB	0.149	0.037	2.688	898	0.106	0.022	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
14	PDB:4g1eB	0.135	0.053	3.513	709	0.106	0.028	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:3t5oA	0.155	0.035	4.909	871	0.064	0.014	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
16	PDB:4fl2A	0.113	0.044	5.612	555	0.032	0.011	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:2a7rD	0.099	0.062	6.000	317	0.021	0.013	2a7rD.pdb.gz	Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
18	PDB:7btbX	0.076	0.097	6.000	141	0.059	0.078	7btbX.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:7wb4c	0.117	0.066	6.000	346	0.032	0.017	7wb4c.pdb.gz
20	PDB:7nkyO	0.112	0.052	6.415	427	0.011	0.005	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13385	2.08e-141	393	188	1.000	1.000	TDGF1_HUMAN Protein Cripto OS=Homo sapiens OX=9606 GN=CRIPTO PE=1 SV=1
2	P51864	6.31e-136	379	188	0.968	0.968	TDGF3_HUMAN Putative protein CRIPTO3 OS=Homo sapiens OX=9606 GN=CRIPTO3 PE=5 SV=1
3	P51865	4.69e-81	239	171	0.638	0.702	TDGF1_MOUSE Teratocarcinoma-derived growth factor OS=Mus musculus OX=10090 GN=Cripto PE=1 SV=2
4	F1Q691	5.52e-27	102	190	0.250	0.247	F1Q691_DANRE Cryptic protein isoform 1 precursor OS=Danio rerio OX=7955 GN=cb85 PE=3 SV=1
5	A7MCB2	9.71e-27	102	183	0.245	0.251	A7MCB2_DANRE Cryptic protein isoform 2 precursor OS=Danio rerio OX=7955 GN=oep PE=2 SV=1
6	Q91649	6.28e-26	100	190	0.277	0.274	Q91649_XENLA Fibroblast growth factor receptor ligand 1 OS=Xenopus laevis OX=8355 GN=cripto1.3.L PE=2 SV=1
7	P97766	8.46e-19	82.0	202	0.186	0.173	CFC1_MOUSE Cryptic protein OS=Mus musculus OX=10090 GN=Cfc1 PE=1 SV=1
8	P0CG37	1.42e-18	81.6	223	0.191	0.161	CFC1_HUMAN Cryptic protein OS=Homo sapiens OX=9606 GN=CFC1 PE=1 SV=1
9	F1LV65	2.00e-18	80.1	170	0.186	0.206	F1LV65_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=4
10	A0A8I6GC89	2.16e-18	80.9	201	0.186	0.174	A0A8I6GC89_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=1
11	O88277	8.87e-07	50.4	4351	0.128	0.006	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
12	Q9NYQ8	6.54e-06	48.1	4349	0.138	0.006	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
13	Q2PZL6	2.45e-04	43.5	4981	0.128	0.005	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
14	Q6V0I7	0.001	41.2	4981	0.117	0.004	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
15	Q9Y5W5	0.001	40.8	379	0.096	0.047	WIF1_HUMAN Wnt inhibitory factor 1 OS=Homo sapiens OX=9606 GN=WIF1 PE=1 SV=3
16	Q9WUA1	0.002	40.4	379	0.096	0.047	WIF1_MOUSE Wnt inhibitory factor 1 OS=Mus musculus OX=10090 GN=Wif1 PE=2 SV=1
17	A0MZ89	0.004	36.6	58	0.122	0.397	A0MZ89_PIG NOTCH1 (Fragment) OS=Sus scrofa OX=9823 PE=2 SV=1
18	A0A087WRT4	0.006	39.3	4602	0.106	0.004	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
19	A0A1L1SQU7	0.006	39.3	4645	0.106	0.004	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
20	F2Z4A3	0.006	39.3	4590	0.106	0.004	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09443 CFC	5.5e-13	59.8	Cripto_Frl-1_Cryptic (CFC)
2	PF00008 EGF	35	16.1	EGF-like domain
3	PF07974 EGF_2	39	16.0	EGF-like domain
4	PF12661 hEGF	1.4e+02	14.5	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442656	0.997	Activin receptor type-1B
2	9606.ENSP00000324173	0.993	78 kDa glucose-regulated protein
3	9606.ENSP00000264039	0.992	Glypican-1
4	9606.ENSP00000241416	0.991	Activin receptor type-2A
5	9606.ENSP00000262160	0.983	Mothers against decapentaplegic homolog 2
6	9606.ENSP00000259915	0.979	POU domain, class 5, transcription factor 1
7	9606.ENSP00000243349	0.978	Activin receptor type-1C
8	9606.ENSP00000229307	0.976	Homeobox protein NANOG
9	9606.ENSP00000323588	0.967	Transcription factor SOX-2
10	9606.ENSP00000287139	0.964	Nodal homolog
11	9606.ENSP00000340361	0.963	Activin receptor type-2B
12	9606.ENSP00000332973	0.949	Mothers against decapentaplegic homolog 3
13	9606.ENSP00000370297	0.947	Cerberus
14	9606.ENSP00000420267	0.938	Nuclear receptor subfamily 6 group A member 1
15	9606.ENSP00000362680	0.933	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000323155	0.927	DAN domain family member 5
17	9606.ENSP00000272134	0.921	Left-right determination factor 1
18	9606.ENSP00000337825	0.912	Tyrosine-protein kinase Lck
19	9606.ENSP00000355785	0.906	Left-right determination factor 2
20	9606.ENSP00000462468	0.906	Tyrosine-protein kinase Yes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.993	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048856	0.982	anatomical structure development
GO:0032501	0.981	multicellular organismal process
GO:0048518	0.980	positive regulation of biological process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051716	0.971	cellular response to stimulus
GO:0048583	0.968	regulation of response to stimulus
GO:0007154	0.958	cell communication
GO:0007275	0.948	multicellular organism development
GO:0007165	0.945	signal transduction
GO:0010604	0.940	positive regulation of macromolecule metabolic process
GO:0048522	0.936	positive regulation of cellular process
GO:0023051	0.920	regulation of signaling
GO:0010646	0.920	regulation of cell communication
GO:0009966	0.904	regulation of signal transduction
GO:0048519	0.897	negative regulation of biological process
GO:0048523	0.892	negative regulation of cellular process
GO:0080090	0.891	regulation of primary metabolic process
GO:0051171	0.885	regulation of nitrogen compound metabolic process
GO:0048731	0.880	system development
GO:0031323	0.879	regulation of cellular metabolic process
GO:0051173	0.865	positive regulation of nitrogen compound metabolic process
GO:0031325	0.864	positive regulation of cellular metabolic process
GO:0048513	0.859	animal organ development
GO:0009653	0.854	anatomical structure morphogenesis
GO:0048869	0.835	cellular developmental process
GO:0030154	0.809	cell differentiation
GO:0010468	0.795	regulation of gene expression
GO:0040012	0.712	regulation of locomotion
GO:0042127	0.710	regulation of cell population proliferation
GO:0048584	0.707	positive regulation of response to stimulus
GO:0007166	0.705	cell surface receptor signaling pathway
GO:0023056	0.700	positive regulation of signaling
GO:0010647	0.700	positive regulation of cell communication
GO:0051239	0.682	regulation of multicellular organismal process
GO:0071704	0.673	organic substance metabolic process
GO:0044237	0.672	cellular metabolic process
GO:0044238	0.664	primary metabolic process
GO:0009967	0.663	positive regulation of signal transduction
GO:0065009	0.651	regulation of molecular function
GO:0070848	0.644	response to growth factor
GO:0043170	0.640	macromolecule metabolic process
GO:0006807	0.637	nitrogen compound metabolic process
GO:0051246	0.609	regulation of protein metabolic process
GO:0009889	0.576	regulation of biosynthetic process
GO:0010556	0.565	regulation of macromolecule biosynthetic process
GO:0031326	0.565	regulation of cellular biosynthetic process
GO:0019219	0.565	regulation of nucleobase-containing compound metabolic process
GO:0007167	0.553	enzyme-linked receptor protein signaling pathway
GO:0051247	0.546	positive regulation of protein metabolic process
GO:0071363	0.545	cellular response to growth factor stimulus
GO:0030334	0.511	regulation of cell migration
GO:0042327	0.508	positive regulation of phosphorylation
GO:1902531	0.507	regulation of intracellular signal transduction
GO:0008284	0.505	positive regulation of cell population proliferation
GO:0051252	0.499	regulation of RNA metabolic process
GO:2001141	0.485	regulation of RNA biosynthetic process
GO:0006355	0.483	regulation of DNA-templated transcription
GO:1902533	0.465	positive regulation of intracellular signal transduction
GO:0044093	0.449	positive regulation of molecular function
GO:0019538	0.445	protein metabolic process
GO:0031399	0.436	regulation of protein modification process
GO:0042221	0.429	response to chemical
GO:0050790	0.409	regulation of catalytic activity
GO:0001932	0.394	regulation of protein phosphorylation
GO:0010941	0.385	regulation of cell death
GO:0036211	0.367	protein modification process
GO:0042981	0.364	regulation of apoptotic process
GO:0006793	0.357	phosphorus metabolic process
GO:0050793	0.352	regulation of developmental process
GO:0001934	0.350	positive regulation of protein phosphorylation
GO:0009888	0.348	tissue development
GO:0009891	0.333	positive regulation of biosynthetic process
GO:0045935	0.333	positive regulation of nucleobase-containing compound metabolic process
GO:0072359	0.327	circulatory system development
GO:0006357	0.327	regulation of transcription by RNA polymerase II
GO:0006950	0.324	response to stress
GO:0010557	0.323	positive regulation of macromolecule biosynthetic process
GO:0031328	0.323	positive regulation of cellular biosynthetic process
GO:0009790	0.320	embryo development
GO:0040017	0.311	positive regulation of locomotion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.958	extracellular region
GO:0005615	0.847	extracellular space
GO:0009986	0.748	cell surface
GO:0005622	0.723	intracellular anatomical structure
GO:0043231	0.666	intracellular membrane-bounded organelle
GO:0005737	0.607	cytoplasm
GO:0070013	0.399	intracellular organelle lumen
GO:0005634	0.327	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]