StarFunc result for job id P13497

User Input

>input (986 residues)
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVN
TFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST
PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY
GVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHS
DDTITKKGFHLRYTSTKFQDTLHSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QEK5	0.702	0.702	0.000	986	0.770	0.770	A0A2R8QEK5.pdb.gz
2	AFDB:O43897	0.756	0.738	0.000	1013	0.725	0.706	O43897.pdb.gz	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
3	AFDB:O57460	0.555	0.537	0.000	1022	0.728	0.703	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
4	AFDB:P25723	0.510	0.477	0.000	1067	0.408	0.377	P25723.pdb.gz	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
5	AFDB:P98063	0.563	0.560	0.000	991	0.960	0.956	P98063.pdb.gz	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
6	AFDB:P98070	0.623	0.854	0.000	707	0.565	0.788	P98070.pdb.gz	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
7	AFDB:Q8JI28	0.798	0.783	0.000	1007	0.719	0.704	Q8JI28.pdb.gz	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
8	AFDB:Q9VC47	0.734	0.514	0.000	1464	0.452	0.305	Q9VC47.pdb.gz	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
9	AFDB:Q9Y6L7	0.687	0.668	0.000	1015	0.752	0.730	Q9Y6L7.pdb.gz	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
10	AFDB:Q60997	0.123	0.070	8.423E-56	2085	0.190	0.090	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
11	PDB:7b01A	0.092	0.148	2.855E-10	588	0.047	0.078	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
12	PDB:8a7eC	0.089	0.062	8.019E-8	1524	0.114	0.073	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
13	PDB:7ufgA	0.098	0.088	4.236E-7	1151	0.096	0.083	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:4bxsV	0.067	0.058	1.622E-6	1262	0.058	0.045	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
15	PDB:7ufgB	0.098	0.084	5.008E-6	1182	0.093	0.078	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:1kcwA	0.063	0.061	6.207E-6	1017	0.065	0.063	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
17	PDB:6vlsD	0.084	0.086	8.567E-6	963	0.050	0.051	6vlsD.pdb.gz
18	PDB:7kveB	0.093	0.073	1.120E-5	1374	0.066	0.047	7kveB.pdb.gz
19	PDB:5n4lA	0.061	0.060	1.722E-5	1034	0.071	0.068	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
20	PDB:5lwxA	0.059	0.092	2.376E-5	554	0.065	0.116	5lwxA.pdb.gz	Structure and function of Aspergillus niger laccase McoG

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M798	0.0	1914	990	0.957	0.954	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
2	F1REM3	0.0	1645	976	0.773	0.781	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
3	O43897	0.0	1553	1013	0.721	0.702	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
4	O57460	0.0	1554	1022	0.722	0.697	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
5	P13497	0.0	2053	986	1.000	1.000	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
6	P25723	0.0	801	1067	0.401	0.370	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
7	P98063	0.0	1913	991	0.956	0.952	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
8	P98070	0.0	1176	707	0.563	0.785	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
9	Q2ABP1	0.0	1637	986	0.773	0.773	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
10	Q62381	0.0	1522	1013	0.703	0.684	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
11	Q8JI28	0.0	1545	1007	0.720	0.705	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
12	Q9VC47	0.0	940	1464	0.453	0.305	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
13	Q9WVM6	0.0	1566	1012	0.738	0.719	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
14	Q9Y6L7	0.0	1572	1015	0.744	0.723	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
15	Q49II7	6.64e-120	375	422	0.186	0.434	Q49II7_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
16	Q49IJ1	1.01e-119	374	422	0.186	0.434	Q49IJ1_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
17	Q49IK4	1.07e-119	374	422	0.186	0.434	Q49IK4_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
18	Q49IJ0	1.11e-119	374	422	0.186	0.434	Q49IJ0_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
19	Q49II5	1.35e-119	374	422	0.186	0.434	Q49II5_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1
20	Q49II0	1.36e-119	374	422	0.186	0.434	Q49II0_DROME Metalloendopeptidase (Fragment) OS=Drosophila melanogaster OX=7227 GN=tok PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	2.3e-70	247.7	Astacin (Peptidase family M12A)
2	PF17907 AWS	5e+02	12.1	AWS domain
3	PF12662 cEGF	4.3e-07	41.0	Complement Clr-like EGF-like
4	PF00431 CUB	7.8e-188	623.4	CUB domain
5	PF02408 CUB_2	7.6	17.7	CUB-like domain
6	PF00008 EGF	0.045	25.3	EGF-like domain
7	PF12947 EGF_3	0.0027	29.1	EGF domain
8	PF07645 EGF_CA	6.6e-10	50.3	Calcium-binding EGF domain
9	PF12946 EGF_MSP1_1	20	16.6	MSP1 EGF domain 1
10	PF14670 FXa_inhibition	9.2e-15	66.0	Coagulation Factor Xa inhibitory site
11	PF12661 hEGF	0.034	26.0	Human growth factor-like EGF
12	PF00413 Peptidase_M10	14	17.0	Matrixin
13	PF06247 Plasmod_Pvs28	5.1e+02	12.4	Pvs28 EGF domain
14	PF13583 Reprolysin_4	1.5e+02	13.4	Metallo-peptidase family M12B Reprolysin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305714

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369071	0.983	Periostin
2	9606.ENSP00000204604	0.981	Chordin
3	9606.ENSP00000304408	0.971	Collagen alpha-1(III) chain
4	9606.ENSP00000360882	0.970	Collagen alpha-1(V) chain
5	9606.ENSP00000225964	0.969	Collagen alpha-1(I) chain
6	9606.ENSP00000231004	0.967	Protein-lysine 6-oxidase
7	9606.ENSP00000324532	0.967	Laminin subunit alpha-3
8	9606.ENSP00000261921	0.965	Lysyl oxidase homolog 1
9	9606.ENSP00000297268	0.962	Collagen alpha-2(I) chain
10	9606.ENSP00000363827	0.960	Basement membrane-specific heparan sulfate proteoglycan core protein
11	9606.ENSP00000264094	0.956	Lysyl oxidase homolog 3
12	9606.ENSP00000373783	0.953	Lysyl oxidase homolog 2
13	9606.ENSP00000375778	0.953	Laminin subunit beta-3
14	9606.ENSP00000264144	0.951	Laminin subunit gamma-2
15	9606.ENSP00000364000	0.950	Collagen alpha-2(V) chain
16	9606.ENSP00000260702	0.949	Lysyl oxidase homolog 4
17	9606.ENSP00000332371	0.946	Collagen alpha-1(VII) chain
18	9606.ENSP00000348385	0.939	Collagen alpha-1(XXVII) chain
19	9606.ENSP00000369889	0.930	Collagen alpha-1(II) chain
20	9606.ENSP00000359114	0.929	Collagen alpha-1(XI) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004175	1.000	endopeptidase activity
GO:0004222	0.976	metalloendopeptidase activity
GO:0004252	0.824	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.993	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.987	cellular process
GO:0001501	0.968	skeletal system development
GO:0065007	0.956	biological regulation
GO:0050789	0.954	regulation of biological process
GO:0071704	0.944	organic substance metabolic process
GO:0044238	0.937	primary metabolic process
GO:0019538	0.918	protein metabolic process
GO:0043062	0.910	extracellular structure organization
GO:0045229	0.906	external encapsulating structure organization
GO:0006508	0.884	proteolysis
GO:0030198	0.775	extracellular matrix organization
GO:0050794	0.741	regulation of cellular process
GO:0050793	0.731	regulation of developmental process
GO:0048518	0.713	positive regulation of biological process
GO:0051239	0.670	regulation of multicellular organismal process
GO:0030199	0.660	collagen fibril organization
GO:0048519	0.469	negative regulation of biological process
GO:0050896	0.431	response to stimulus
GO:0048513	0.430	animal organ development
GO:0009888	0.312	tissue development
GO:0009653	0.312	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.967	cell periphery
GO:0043227	0.841	membrane-bounded organelle
GO:0005615	0.745	extracellular space
GO:0012505	0.414	endomembrane system
GO:0043231	0.386	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.976	Metalloendopeptidases.
EC:3.4.21.-	0.824	Serine endopeptidases.

[back to server]