StarFunc result for job id P13498

User Input

>input (195 residues)
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP
GGPQVNPIPVTDEVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13498	1.000	1.000	2.993E-29	195	1.000	1.000	P13498.pdb.gz	CY24A_HUMAN Cytochrome b-245 light chain OS=Homo sapiens OX=9606 GN=CYBA PE=1 SV=3
2	AFDB:Q61462	0.754	0.766	3.861E-25	192	0.856	0.870	Q61462.pdb.gz	CY24A_MOUSE Cytochrome b-245 light chain OS=Mus musculus OX=10090 GN=Cyba PE=1 SV=3
3	PDB:7u8gB	0.672	0.990	2.307E-18	132	0.677	1.000	7u8gB.pdb.gz	Structure of the core human NADPH oxidase NOX2.
4	AFDB:Q6PH62	0.706	0.743	3.348E-18	185	0.564	0.595	Q6PH62.pdb.gz	Q6PH62_DANRE Cytochrome b-245 light chain OS=Danio rerio OX=7955 GN=zgc:66077 PE=2 SV=1
5	AFDB:Q867X6	0.509	0.820	1.020E-5	118	0.190	0.314	Q867X6.pdb.gz	CY24A_DICDI Superoxide-generating NADPH oxidase light chain subunit OS=Dictyostelium discoideum OX=44689 GN=cybA PE=2 SV=1
6	AFDB:Q95T12	0.479	0.482	1.249E-3	194	0.159	0.160	Q95T12.pdb.gz	FLOWR_DROME Calcium channel flower OS=Drosophila melanogaster OX=7227 GN=fwe PE=1 SV=1
7	AFDB:O95500	0.280	0.242	2.930E-2	239	0.159	0.130	O95500.pdb.gz	CLD14_HUMAN Claudin-14 OS=Homo sapiens OX=9606 GN=CLDN14 PE=1 SV=1
8	AFDB:P9WIR9	0.326	0.228	5.083E-2	303	0.205	0.132	P9WIR9.pdb.gz	34KD_MYCTU 34 kDa antigenic protein homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0954 PE=1 SV=1
9	AFDB:Q9ES61	0.237	0.216	6.865E-2	226	0.092	0.080	Q9ES61.pdb.gz	Q9ES61_MOUSE Chandra protein OS=Mus musculus OX=10090 GN=Ms4a4b PE=1 SV=1
10	PDB:4ej4A	0.195	0.110	1.655E-1	442	0.128	0.057	4ej4A.pdb.gz	Structure of the delta opioid receptor bound to naltrindole
11	PDB:7khro	0.200	0.239	2.125E-1	151	0.062	0.079	7khro.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
12	PDB:7pmxA	0.191	0.078	2.597E-1	657	0.103	0.030	7pmxA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
13	PDB:7xz5R	0.218	0.161	2.730E-1	292	0.082	0.055	7xz5R.pdb.gz	Structural identification of lysophosphatidylcholines as activating ligands for orphan receptor GPR119.
14	PDB:4xesA	0.198	0.109	3.018E-1	471	0.118	0.049	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
15	AFDB:Q96B33	0.288	0.216	3.242E-1	292	0.154	0.103	Q96B33.pdb.gz	CLD23_HUMAN Claudin-23 OS=Homo sapiens OX=9606 GN=CLDN23 PE=1 SV=2
16	PDB:5voxR	0.188	0.174	3.335E-1	213	0.092	0.085	5voxR.pdb.gz
17	AFDB:Q12207	0.379	0.418	3.768E-1	173	0.118	0.133	Q12207.pdb.gz	NCE2_YEAST Non-classical export protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCE102 PE=1 SV=1
18	PDB:6c6lH	0.168	0.188	4.285E-1	160	0.123	0.150	6c6lH.pdb.gz
19	PDB:1x8zA	0.358	0.430	5.504E-1	151	0.026	0.033	1x8zA.pdb.gz
20	PDB:7wsmA	0.150	0.083	5.786E-1	464	0.123	0.052	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13498	3.24e-140	390	195	1.000	1.000	CY24A_HUMAN Cytochrome b-245 light chain OS=Homo sapiens OX=9606 GN=CYBA PE=1 SV=3
2	Q61462	4.29e-112	319	192	0.882	0.896	CY24A_MOUSE Cytochrome b-245 light chain OS=Mus musculus OX=10090 GN=Cyba PE=1 SV=3
3	Q62737	3.88e-111	317	192	0.892	0.906	CY24A_RAT Cytochrome b-245 light chain OS=Rattus norvegicus OX=10116 GN=Cyba PE=1 SV=3
4	Q6PH62	1.34e-63	196	185	0.549	0.578	Q6PH62_DANRE Cytochrome b-245 light chain OS=Danio rerio OX=7955 GN=zgc:66077 PE=2 SV=1
5	Q867X6	0.003	38.1	118	0.190	0.314	CY24A_DICDI Superoxide-generating NADPH oxidase light chain subunit OS=Dictyostelium discoideum OX=44689 GN=cybA PE=2 SV=1
6	Q96QF7	0.22	34.3	691	0.067	0.019	GCNA_HUMAN Germ cell nuclear acidic protein OS=Homo sapiens OX=9606 GN=GCNA PE=1 SV=1
7	P96285	0.38	33.9	1616	0.154	0.019	PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks1 PE=1 SV=4
8	Q8T4F9	0.61	33.1	933	0.087	0.018	Q8T4F9_DROME SD03848p OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=2 SV=1
9	A2AGT5	0.71	33.1	2032	0.097	0.009	CKAP5_MOUSE Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1
10	Q7TXK8	0.76	33.1	2112	0.154	0.014	MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=pks15/1 PE=1 SV=1
11	Q9D2G5	0.98	32.7	1434	0.067	0.009	SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus OX=10090 GN=Synj2 PE=1 SV=2
12	Q9VCH1	1.4	32.0	2072	0.087	0.008	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
13	Q3KR75	1.6	32.0	699	0.133	0.037	Q3KR75_RAT Eng protein OS=Rattus norvegicus OX=10116 GN=Eng PE=2 SV=1
14	A0A1Y7VME9	1.7	32.0	1763	0.097	0.011	A0A1Y7VME9_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
15	A0A1Y7VMH7	1.7	32.0	1672	0.097	0.011	A0A1Y7VMH7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
16	B2RXL7	1.7	32.0	1672	0.097	0.011	B2RXL7_MOUSE Kidins220 protein OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
17	Q80SX9	1.7	32.0	1554	0.097	0.012	Q80SX9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
18	E9Q9B7	1.9	31.6	1793	0.097	0.011	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
19	A0A1Y7VNF8	2.1	31.6	1182	0.097	0.016	A0A1Y7VNF8_MOUSE Kinase D-interacting substrate 220 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
20	Q3V2X2	2.1	31.6	1181	0.097	0.016	Q3V2X2_MOUSE KAP NTPase domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10233 Cg6151-P	1.7	20.3	Uncharacterized conserved protein CG6151-P
2	PF05038 Cytochrom_B558a	1.4e-99	342.7	Cytochrome Cytochrome b558 alpha-subunit
3	PF03729 DUF308	2.7e+02	13.3	Short repeat of unknown function (DUF308)
4	PF19495 DUF6030	2.6e+02	12.6	Family of unknown function (DUF6030)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289473	0.999	Neutrophil cytosol factor 1
2	9606.ENSP00000356505	0.999	Neutrophil cytosol factor 2
3	9606.ENSP00000367851	0.999	Cytochrome b-245 heavy chain
4	9606.ENSP00000380334	0.999	Neutrophil cytosol factor 4
5	9606.ENSP00000380450	0.999	NADPH oxidase organizer 1
6	9606.ENSP00000263317	0.998	NADPH oxidase 4
7	9606.ENSP00000362057	0.998	NADPH oxidase 1
8	9606.ENSP00000159060	0.996	NADPH oxidase 3
9	9606.ENSP00000249071	0.993	Ras-related C3 botulinum toxin substrate 2
10	9606.ENSP00000373518	0.988	NADPH oxidase 5
11	9606.ENSP00000475924	0.988	DNA polymerase delta interacting protein 2
12	9606.ENSP00000342848	0.987	NADPH oxidase activator 1
13	9606.ENSP00000317997	0.978	Dual oxidase 1
14	9606.ENSP00000451828	0.963	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000348461	0.950	Ras-related C3 botulinum toxin substrate 1
16	9606.ENSP00000294728	0.942	Vascular cell adhesion protein 1
17	9606.ENSP00000348215	0.906	SH3 and PX domain-containing protein 2A
18	9606.ENSP00000475084	0.896	Dual oxidase 2
19	9606.ENSP00000296343	0.894	Run domain Beclin-1-interacting and cysteine-rich domain-containing protein
20	9606.ENSP00000378217	0.853	Protein kinase C delta type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.998	catalytic activity
GO:0016491	0.981	oxidoreductase activity
GO:0016175	0.958	superoxide-generating NAD(P)H oxidase activity
GO:0046983	0.754	protein dimerization activity
GO:0046982	0.723	protein heterodimerization activity
GO:0019904	0.717	protein domain specific binding
GO:0009055	0.702	electron transfer activity
GO:0017124	0.702	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.993	positive regulation of cellular process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0006950	0.986	response to stress
GO:0044237	0.985	cellular metabolic process
GO:0072593	0.983	reactive oxygen species metabolic process
GO:0051239	0.982	regulation of multicellular organismal process
GO:2000377	0.981	regulation of reactive oxygen species metabolic process
GO:0009893	0.973	positive regulation of metabolic process
GO:0065008	0.971	regulation of biological quality
GO:0009605	0.968	response to external stimulus
GO:0006801	0.951	superoxide metabolic process
GO:0032501	0.949	multicellular organismal process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:2000379	0.945	positive regulation of reactive oxygen species metabolic process
GO:0048583	0.942	regulation of response to stimulus
GO:0071704	0.941	organic substance metabolic process
GO:0051050	0.902	positive regulation of transport
GO:0002376	0.898	immune system process
GO:0010604	0.879	positive regulation of macromolecule metabolic process
GO:0009607	0.868	response to biotic stimulus
GO:0048519	0.868	negative regulation of biological process
GO:0051240	0.866	positive regulation of multicellular organismal process
GO:0001819	0.859	positive regulation of cytokine production
GO:0006952	0.858	defense response
GO:0044419	0.852	biological process involved in interspecies interaction between organisms
GO:0044093	0.848	positive regulation of molecular function
GO:0048584	0.848	positive regulation of response to stimulus
GO:0051716	0.846	cellular response to stimulus
GO:0043207	0.843	response to external biotic stimulus
GO:0071310	0.838	cellular response to organic substance
GO:0032103	0.836	positive regulation of response to external stimulus
GO:0002684	0.824	positive regulation of immune system process
GO:0051707	0.824	response to other organism
GO:0031347	0.823	regulation of defense response
GO:0006955	0.809	immune response
GO:1901701	0.768	cellular response to oxygen-containing compound
GO:0071840	0.755	cellular component organization or biogenesis
GO:0010646	0.745	regulation of cell communication
GO:0009966	0.742	regulation of signal transduction
GO:0051171	0.734	regulation of nitrogen compound metabolic process
GO:0050790	0.732	regulation of catalytic activity
GO:0016043	0.732	cellular component organization
GO:0003013	0.726	circulatory system process
GO:0043085	0.724	positive regulation of catalytic activity
GO:0051179	0.719	localization
GO:0009967	0.713	positive regulation of signal transduction
GO:0009889	0.708	regulation of biosynthetic process
GO:0007154	0.701	cell communication
GO:0023052	0.690	signaling
GO:0098542	0.689	defense response to other organism
GO:0090322	0.671	regulation of superoxide metabolic process
GO:0045087	0.670	innate immune response
GO:0080090	0.653	regulation of primary metabolic process
GO:1901698	0.630	response to nitrogen compound
GO:0009719	0.618	response to endogenous stimulus
GO:0044085	0.616	cellular component biogenesis
GO:0022607	0.608	cellular component assembly
GO:0006810	0.606	transport
GO:0009628	0.605	response to abiotic stimulus
GO:0060627	0.595	regulation of vesicle-mediated transport
GO:1901699	0.590	cellular response to nitrogen compound
GO:0010243	0.572	response to organonitrogen compound
GO:0008015	0.544	blood circulation
GO:0051173	0.538	positive regulation of nitrogen compound metabolic process
GO:0048523	0.533	negative regulation of cellular process
GO:0014070	0.527	response to organic cyclic compound
GO:0050878	0.503	regulation of body fluid levels
GO:0008217	0.489	regulation of blood pressure
GO:1903555	0.481	regulation of tumor necrosis factor superfamily cytokine production
GO:0043933	0.474	protein-containing complex organization
GO:0003073	0.472	regulation of systemic arterial blood pressure
GO:1901652	0.469	response to peptide
GO:0042592	0.466	homeostatic process
GO:0019725	0.463	cellular homeostasis
GO:0065003	0.454	protein-containing complex assembly
GO:0007165	0.447	signal transduction
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0048878	0.402	chemical homeostasis
GO:0055082	0.393	intracellular chemical homeostasis
GO:0044238	0.378	primary metabolic process
GO:0017004	0.377	cytochrome complex assembly
GO:0009725	0.361	response to hormone
GO:1902531	0.351	regulation of intracellular signal transduction
GO:0051246	0.346	regulation of protein metabolic process
GO:0031349	0.339	positive regulation of defense response
GO:0009891	0.334	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:1990204	1.000	oxidoreductase complex
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0098797	0.999	plasma membrane protein complex
GO:0031410	0.992	cytoplasmic vesicle
GO:0031090	0.941	organelle membrane
GO:0005783	0.929	endoplasmic reticulum
GO:0005829	0.913	cytosol
GO:0099503	0.875	secretory vesicle
GO:0098588	0.870	bounding membrane of organelle
GO:0030141	0.864	secretory granule
GO:0030659	0.729	cytoplasmic vesicle membrane
GO:0043020	0.723	NADPH oxidase complex
GO:0030139	0.689	endocytic vesicle
GO:0005789	0.674	endoplasmic reticulum membrane
GO:0045335	0.667	phagocytic vesicle
GO:0030667	0.647	secretory granule membrane
GO:0070820	0.557	tertiary granule
GO:0030666	0.436	endocytic vesicle membrane
GO:0030670	0.405	phagocytic vesicle membrane
GO:0070821	0.387	tertiary granule membrane
GO:0005576	0.377	extracellular region
GO:0035579	0.361	specific granule membrane
GO:0043232	0.359	intracellular non-membrane-bounded organelle
GO:0005634	0.325	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.981	Oxidoreductases.
EC:1.6.3.-	0.958	With oxygen as acceptor.

[back to server]