StarFunc result for job id P13500

User Input

>input (99 residues)
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13500	1.000	1.000	1.771E-18	99	1.000	1.000	P13500.pdb.gz	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
2	AFDB:P80098	0.808	0.808	9.437E-15	99	0.737	0.737	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
3	AFDB:P51671	0.764	0.777	4.601E-14	97	0.697	0.711	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
4	AFDB:P80075	0.667	0.667	5.608E-14	99	0.687	0.687	P80075.pdb.gz	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
5	AFDB:D4ABS1	0.760	0.767	1.613E-13	98	0.616	0.622	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
6	AFDB:Q99616	0.865	0.873	2.734E-13	98	0.636	0.643	Q99616.pdb.gz	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
7	AFDB:P48298	0.806	0.822	2.415E-12	97	0.515	0.526	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
8	AFDB:P10148	0.861	0.595	6.942E-12	148	0.535	0.358	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
9	AFDB:P14844	0.770	0.536	9.040E-12	148	0.505	0.338	P14844.pdb.gz	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
10	AFDB:Q62401	0.689	0.657	9.657E-12	104	0.596	0.567	Q62401.pdb.gz	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
11	PDB:1domA	0.669	0.854	1.035E-11	76	0.768	1.000	1domA.pdb.gz
12	PDB:1esrA	0.712	0.913	3.655E-10	76	0.475	0.618	1esrA.pdb.gz
13	PDB:1bo0A	0.587	0.743	1.281E-9	76	0.545	0.711	1bo0A.pdb.gz
14	PDB:2ra4B	0.571	0.848	1.681E-8	65	0.384	0.585	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
15	PDB:2mpmA	0.539	0.693	2.189E-8	74	0.485	0.649	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
16	PDB:4zltF	0.556	0.866	1.007E-6	62	0.253	0.403	4zltF.pdb.gz
17	PDB:2q8tB	0.583	0.870	3.528E-6	65	0.222	0.338	2q8tB.pdb.gz
18	PDB:5yamA	0.557	0.773	5.600E-6	69	0.202	0.290	5yamA.pdb.gz
19	PDB:7f1tA	0.574	0.139	1.014E-5	423	0.232	0.054	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
20	PDB:1nr4E	0.632	0.887	1.411E-5	69	0.182	0.261	1nr4E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13500	1.31e-69	204	99	1.000	1.000	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
2	Q62401	1.84e-43	138	104	0.657	0.625	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
3	Q99616	2.18e-43	138	98	0.646	0.653	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
4	P80098	2.22e-39	128	99	0.606	0.606	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
5	P80075	3.97e-38	125	99	0.687	0.687	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
6	P51671	3.25e-37	122	97	0.697	0.711	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
7	D4ABS1	4.29e-35	117	98	0.495	0.500	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
8	P10148	3.40e-33	114	148	0.515	0.345	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
9	P14844	1.42e-31	110	148	0.505	0.338	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
10	P48298	2.02e-30	105	97	0.515	0.526	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
11	Q9QXY8	8.37e-30	103	97	0.535	0.546	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
12	Q9Z121	2.26e-26	95.1	97	0.465	0.474	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
13	P97545	1.04e-25	93.6	97	0.434	0.443	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
14	Q03366	1.46e-22	85.5	97	0.576	0.588	CCL7_MOUSE C-C motif chemokine 7 OS=Mus musculus OX=10090 GN=Ccl7 PE=3 SV=1
15	P16619	1.14e-16	70.5	93	0.364	0.387	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
16	P13236	3.75e-16	69.3	92	0.333	0.359	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
17	P50230	1.92e-15	67.4	92	0.333	0.359	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
18	Q9JKC0	2.59e-14	65.1	119	0.354	0.294	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
19	O00175	2.98e-14	65.1	119	0.343	0.286	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
20	P10147	1.38e-13	62.8	92	0.343	0.370	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	7.4e-16	69.4	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292301	0.999	C-C chemokine receptor type 2
2	9606.ENSP00000306512	0.995	Interleukin-8
3	9606.ENSP00000292303	0.994	C-C chemokine receptor type 5
4	9606.ENSP00000385675	0.994	Interleukin-6
5	9606.ENSP00000263341	0.993	Interleukin-1 beta
6	9606.ENSP00000398698	0.992	Tumor necrosis factor
7	9606.ENSP00000305651	0.991	C-X-C motif chemokine 10
8	9606.ENSP00000379110	0.989	Growth-regulated alpha protein
9	9606.ENSP00000412237	0.989	Interleukin-10
10	9606.ENSP00000296871	0.988	Granulocyte-macrophage colony-stimulating factor
11	9606.ENSP00000296140	0.987	C-C chemokine receptor type 1
12	9606.ENSP00000231449	0.985	Interleukin-4
13	9606.ENSP00000225474	0.984	Granulocyte colony-stimulating factor
14	9606.ENSP00000357103	0.984	Atypical chemokine receptor 1
15	9606.ENSP00000427279	0.984	C-X-C motif chemokine 2
16	9606.ENSP00000263339	0.983	Interleukin-1 alpha
17	9606.ENSP00000304915	0.983	Interleukin-13
18	9606.ENSP00000351671	0.979	C-C motif chemokine 20
19	9606.ENSP00000219235	0.977	C-C motif chemokine 22
20	9606.ENSP00000280357	0.976	Interleukin-18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.998	CCR chemokine receptor binding
GO:0016301	0.996	kinase activity
GO:0016773	0.851	phosphotransferase activity, alcohol group as acceptor
GO:0140096	0.713	catalytic activity, acting on a protein
GO:0004672	0.679	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0007154	0.988	cell communication
GO:0023052	0.986	signaling
GO:0040012	0.980	regulation of locomotion
GO:0042221	0.979	response to chemical
GO:0007165	0.976	signal transduction
GO:0009605	0.972	response to external stimulus
GO:0030334	0.972	regulation of cell migration
GO:0006950	0.961	response to stress
GO:0006935	0.959	chemotaxis
GO:0002685	0.953	regulation of leukocyte migration
GO:0002376	0.944	immune system process
GO:0048518	0.941	positive regulation of biological process
GO:0006952	0.927	defense response
GO:0048522	0.913	positive regulation of cellular process
GO:0032501	0.892	multicellular organismal process
GO:0006954	0.880	inflammatory response
GO:0070887	0.879	cellular response to chemical stimulus
GO:0048856	0.874	anatomical structure development
GO:0050900	0.849	leukocyte migration
GO:0044419	0.844	biological process involved in interspecies interaction between organisms
GO:0001906	0.833	cell killing
GO:0030335	0.830	positive regulation of cell migration
GO:0060326	0.828	cell chemotaxis
GO:0032103	0.812	positive regulation of response to external stimulus
GO:0048519	0.796	negative regulation of biological process
GO:0031640	0.793	killing of cells of another organism
GO:0071674	0.785	mononuclear cell migration
GO:0010033	0.775	response to organic substance
GO:0002684	0.761	positive regulation of immune system process
GO:0019222	0.754	regulation of metabolic process
GO:0030595	0.754	leukocyte chemotaxis
GO:0048523	0.749	negative regulation of cellular process
GO:0006955	0.745	immune response
GO:0002690	0.743	positive regulation of leukocyte chemotaxis
GO:0060255	0.741	regulation of macromolecule metabolic process
GO:0006959	0.740	humoral immune response
GO:0007267	0.726	cell-cell signaling
GO:0061844	0.721	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0042592	0.716	homeostatic process
GO:0009615	0.711	response to virus
GO:0007275	0.707	multicellular organism development
GO:0042127	0.691	regulation of cell population proliferation
GO:0050793	0.678	regulation of developmental process
GO:0097529	0.672	myeloid leukocyte migration
GO:0071677	0.648	positive regulation of mononuclear cell migration
GO:0034097	0.576	response to cytokine
GO:0048731	0.563	system development
GO:0007166	0.529	cell surface receptor signaling pathway
GO:0009893	0.523	positive regulation of metabolic process
GO:0001944	0.517	vasculature development
GO:0008152	0.500	metabolic process
GO:0051239	0.497	regulation of multicellular organismal process
GO:0006874	0.490	intracellular calcium ion homeostasis
GO:0071704	0.482	organic substance metabolic process
GO:0010604	0.467	positive regulation of macromolecule metabolic process
GO:0071310	0.459	cellular response to organic substance
GO:0065009	0.430	regulation of molecular function
GO:0010468	0.427	regulation of gene expression
GO:0080090	0.401	regulation of primary metabolic process
GO:2000401	0.400	regulation of lymphocyte migration
GO:0023051	0.391	regulation of signaling
GO:0031323	0.387	regulation of cellular metabolic process
GO:0010646	0.386	regulation of cell communication
GO:0051240	0.377	positive regulation of multicellular organismal process
GO:0044238	0.373	primary metabolic process
GO:0051171	0.364	regulation of nitrogen compound metabolic process
GO:0001568	0.363	blood vessel development
GO:0006807	0.326	nitrogen compound metabolic process
GO:0009966	0.320	regulation of signal transduction
GO:0071840	0.319	cellular component organization or biogenesis
GO:0071345	0.316	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0071944	0.530	cell periphery
GO:0005886	0.428	plasma membrane
GO:0043231	0.305	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.996	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.851	Phosphotransferases with an alcohol group as acceptor.

[back to server]