StarFunc result for job id P13501

User Input

>input (91 residues)
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13501	1.000	1.000	3.240E-18	91	1.000	1.000	P13501.pdb.gz	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
2	AFDB:P50231	0.692	0.684	2.880E-15	92	0.802	0.793	P50231.pdb.gz	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
3	AFDB:P50229	0.647	0.641	1.650E-11	92	0.527	0.522	P50229.pdb.gz	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
4	AFDB:P14097	0.674	0.667	2.630E-11	92	0.473	0.467	P14097.pdb.gz	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
5	AFDB:P16619	0.666	0.652	2.630E-11	93	0.484	0.473	P16619.pdb.gz	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
6	PDB:5yamA	0.633	0.815	3.703E-11	69	0.626	0.826	5yamA.pdb.gz
7	AFDB:P13236	0.669	0.664	5.846E-11	92	0.462	0.457	P13236.pdb.gz	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
8	AFDB:P10855	0.644	0.638	8.155E-11	92	0.505	0.500	P10855.pdb.gz	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
9	PDB:6fgpB	0.617	0.798	9.404E-11	68	0.725	0.971	6fgpB.pdb.gz	The solution structure of monomeric CCL5 in complex with a doubly sulfated N-terminal segment of CCR5.
10	AFDB:P50230	0.677	0.669	3.300E-10	92	0.440	0.435	P50230.pdb.gz	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
11	AFDB:Q4KS30	0.785	0.800	4.920E-10	89	0.385	0.393	Q4KS30.pdb.gz	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
12	AFDB:P80098	0.656	0.605	7.841E-10	99	0.352	0.323	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
13	PDB:4zltF	0.636	0.918	7.609E-9	62	0.341	0.500	4zltF.pdb.gz
14	PDB:7f1tA	0.644	0.141	9.548E-8	423	0.319	0.069	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
15	PDB:1esrA	0.645	0.765	1.738E-7	76	0.242	0.289	1esrA.pdb.gz
16	PDB:7f1qR	0.629	0.161	1.738E-7	367	0.319	0.079	7f1qR.pdb.gz
17	PDB:2q8tB	0.653	0.908	1.858E-7	65	0.286	0.400	2q8tB.pdb.gz
18	PDB:2ra4B	0.637	0.886	2.591E-7	65	0.209	0.292	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
19	PDB:4mheA	0.621	0.809	5.390E-7	69	0.264	0.348	4mheA.pdb.gz
20	PDB:1humA	0.628	0.811	1.121E-6	69	0.352	0.464	1humA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13501	8.28e-63	186	91	1.000	1.000	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
2	P30882	1.35e-50	155	91	0.802	0.802	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
3	P50231	6.33e-49	151	92	0.802	0.793	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
4	P16619	4.74e-30	103	93	0.495	0.484	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
5	P10147	1.75e-29	102	92	0.495	0.489	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
6	P50229	2.41e-29	102	92	0.527	0.522	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
7	P10855	8.03e-29	100	92	0.505	0.500	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
8	P13236	4.28e-27	96.7	92	0.462	0.457	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
9	P50230	1.26e-25	92.8	92	0.440	0.435	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
10	P14097	4.59e-23	86.3	92	0.473	0.467	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
11	Q8NHW4	2.37e-22	84.7	92	0.451	0.446	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
12	Q9I8E0	4.11e-22	84.0	89	0.418	0.427	Q9I8E0_CHICK Chemokine C-C motif ligand 4 OS=Gallus gallus OX=9031 GN=K203 PE=2 SV=1
13	Q4KS30	4.49e-22	84.0	89	0.440	0.449	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
14	P55774	6.23e-19	75.9	89	0.385	0.393	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
15	Q16627	7.07e-19	75.9	93	0.363	0.355	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
16	O88430	3.35e-16	68.9	92	0.319	0.315	CCL22_MOUSE C-C motif chemokine 22 OS=Mus musculus OX=10090 GN=Ccl22 PE=2 SV=1
17	Q9Y258	1.21e-15	67.8	94	0.308	0.298	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
18	Q99616	2.05e-14	64.7	98	0.319	0.296	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
19	F5HFL9	2.66e-14	64.3	94	0.264	0.255	F5HFL9_HHV8 K4 OS=Human herpesvirus 8 OX=37296 GN=K4 PE=1 SV=1
20	Q98157	2.66e-14	64.3	94	0.264	0.255	VMI2_HHV8P Viral macrophage inflammatory protein 2 OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=ORF K4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	3.6e-17	73.6	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000474412

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292303	0.999	C-C chemokine receptor type 5
2	9606.ENSP00000296140	0.999	C-C chemokine receptor type 1
3	9606.ENSP00000441600	0.999	C-C chemokine receptor type 3
4	9606.ENSP00000296029	0.997	Platelet factor 4
5	9606.ENSP00000398698	0.990	Tumor necrosis factor
6	9606.ENSP00000263341	0.988	Interleukin-1 beta
7	9606.ENSP00000292301	0.988	C-C chemokine receptor type 2
8	9606.ENSP00000385675	0.988	Interleukin-6
9	9606.ENSP00000412237	0.987	Interleukin-10
10	9606.ENSP00000296871	0.986	Granulocyte-macrophage colony-stimulating factor
11	9606.ENSP00000225474	0.983	Granulocyte colony-stimulating factor
12	9606.ENSP00000263339	0.980	Interleukin-1 alpha
13	9606.ENSP00000305651	0.978	C-X-C motif chemokine 10
14	9606.ENSP00000280357	0.972	Interleukin-18
15	9606.ENSP00000306512	0.966	Interleukin-8
16	9606.ENSP00000386884	0.958	C-X-C chemokine receptor type 4
17	9606.ENSP00000370542	0.957	Syndecan-1
18	9606.ENSP00000362795	0.956	C-X-C chemokine receptor type 3
19	9606.ENSP00000398632	0.955	CD44 antigen
20	9606.ENSP00000379110	0.954	Growth-regulated alpha protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	0.999	chemokine activity
GO:0048020	0.913	CCR chemokine receptor binding
GO:0042802	0.511	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.992	cellular response to stimulus
GO:0002376	0.991	immune system process
GO:0042221	0.988	response to chemical
GO:0007154	0.988	cell communication
GO:0002690	0.988	positive regulation of leukocyte chemotaxis
GO:0006952	0.986	defense response
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0080134	0.985	regulation of response to stress
GO:0008284	0.985	positive regulation of cell population proliferation
GO:0010941	0.983	regulation of cell death
GO:0048523	0.983	negative regulation of cellular process
GO:2000403	0.983	positive regulation of lymphocyte migration
GO:0006954	0.982	inflammatory response
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0070887	0.979	cellular response to chemical stimulus
GO:0009605	0.978	response to external stimulus
GO:0060326	0.971	cell chemotaxis
GO:0044419	0.967	biological process involved in interspecies interaction between organisms
GO:0009607	0.967	response to biotic stimulus
GO:0071674	0.967	mononuclear cell migration
GO:0023052	0.960	signaling
GO:0031347	0.958	regulation of defense response
GO:0051239	0.953	regulation of multicellular organismal process
GO:0097529	0.950	myeloid leukocyte migration
GO:0030595	0.948	leukocyte chemotaxis
GO:0001819	0.943	positive regulation of cytokine production
GO:0002831	0.925	regulation of response to biotic stimulus
GO:0042981	0.924	regulation of apoptotic process
GO:0006955	0.922	immune response
GO:1905517	0.918	macrophage migration
GO:0098542	0.917	defense response to other organism
GO:0051050	0.899	positive regulation of transport
GO:0032501	0.886	multicellular organismal process
GO:0050727	0.885	regulation of inflammatory response
GO:0034097	0.883	response to cytokine
GO:0071310	0.877	cellular response to organic substance
GO:0032502	0.841	developmental process
GO:0060548	0.836	negative regulation of cell death
GO:0051171	0.829	regulation of nitrogen compound metabolic process
GO:0071345	0.825	cellular response to cytokine stimulus
GO:0009615	0.822	response to virus
GO:0031349	0.821	positive regulation of defense response
GO:0044093	0.820	positive regulation of molecular function
GO:0009966	0.820	regulation of signal transduction
GO:0048246	0.816	macrophage chemotaxis
GO:2000404	0.811	regulation of T cell migration
GO:1902531	0.807	regulation of intracellular signal transduction
GO:0031323	0.800	regulation of cellular metabolic process
GO:0007165	0.792	signal transduction
GO:1902533	0.791	positive regulation of intracellular signal transduction
GO:0043069	0.772	negative regulation of programmed cell death
GO:0051247	0.759	positive regulation of protein metabolic process
GO:0007267	0.753	cell-cell signaling
GO:0042325	0.750	regulation of phosphorylation
GO:2001141	0.741	regulation of RNA biosynthetic process
GO:0001775	0.740	cell activation
GO:0031325	0.730	positive regulation of cellular metabolic process
GO:0043066	0.723	negative regulation of apoptotic process
GO:0050793	0.714	regulation of developmental process
GO:0007166	0.693	cell surface receptor signaling pathway
GO:0050790	0.675	regulation of catalytic activity
GO:0031399	0.669	regulation of protein modification process
GO:0009617	0.660	response to bacterium
GO:0051094	0.655	positive regulation of developmental process
GO:0045595	0.642	regulation of cell differentiation
GO:2000106	0.628	regulation of leukocyte apoptotic process
GO:0002237	0.598	response to molecule of bacterial origin
GO:1901700	0.592	response to oxygen-containing compound
GO:0034612	0.587	response to tumor necrosis factor
GO:0065008	0.574	regulation of biological quality
GO:0051179	0.564	localization
GO:0048856	0.560	anatomical structure development
GO:0097530	0.521	granulocyte migration
GO:0071621	0.507	granulocyte chemotaxis
GO:2000107	0.505	negative regulation of leukocyte apoptotic process
GO:0051924	0.498	regulation of calcium ion transport
GO:0071396	0.480	cellular response to lipid
GO:0006355	0.407	regulation of DNA-templated transcription
GO:0019725	0.403	cellular homeostasis
GO:0051234	0.351	establishment of localization
GO:0050776	0.319	regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0005615	0.723	extracellular space
GO:0005622	0.653	intracellular anatomical structure
GO:0005737	0.643	cytoplasm
GO:0071944	0.468	cell periphery
GO:0005886	0.437	plasma membrane
GO:0043231	0.406	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]