StarFunc result for job id P13533

User Input

>input (1939 residues)
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVI
AETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND
NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHY
GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECM
FPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD
PLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKL
MTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
RQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
ERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVN
SLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
KLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ
LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI
LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKM
EGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRN
NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDK
KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
KLRAKSRDIGAKQKMHDEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pa0A	0.339	0.656	0.000	974	0.359	0.716	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
2	PDB:4pa0B	0.340	0.697	0.000	920	0.352	0.741	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
3	AFDB:A0A0G2JY53	0.723	0.731	0.000	1915	0.563	0.570	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
4	AFDB:A0A0N4STT5	0.767	0.742	0.000	2008	0.851	0.822	A0A0N4STT5.pdb.gz
5	AFDB:A7E2Y1	0.728	0.713	0.000	1983	0.682	0.667	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
6	AFDB:B1AR69	0.680	0.680	0.000	1938	0.776	0.776	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
7	AFDB:B3DFS9	0.657	0.646	0.000	1974	0.407	0.400	B3DFS9.pdb.gz
8	AFDB:B8A568	0.761	0.762	0.000	1937	0.769	0.770	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
9	AFDB:B8JLS3	0.725	0.726	0.000	1936	0.828	0.829	B8JLS3.pdb.gz
10	AFDB:E7FD18	0.833	0.831	0.000	1945	0.741	0.739	E7FD18.pdb.gz
11	AFDB:F1QC64	0.636	0.703	0.000	1749	0.349	0.387	F1QC64.pdb.gz
12	AFDB:F1R3G4	0.677	0.660	0.000	1992	0.394	0.384	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
13	PDB:4p7hB	0.339	0.674	3.585E-101	952	0.348	0.708	4p7hB.pdb.gz
14	PDB:5tbyA	0.369	0.714	1.531E-100	954	0.448	0.910	5tbyA.pdb.gz
15	PDB:7mf3B	0.364	0.764	1.238E-65	896	0.228	0.494	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.344	0.658	4.286E-61	995	0.136	0.265	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.361	0.813	2.438E-53	817	0.117	0.278	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:3qwyA	0.023	0.225	1.411E-1	170	0.007	0.082	3qwyA.pdb.gz
19	PDB:4v6iBN	0.024	0.268	3.212E-1	138	0.004	0.051	4v6iBN.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
20	PDB:7wrgA	0.043	0.082	3.898E-1	812	0.026	0.063	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2177	1922	0.577	0.582	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3164	1912	0.797	0.808	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3184	1937	0.798	0.799	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3204	1939	0.808	0.808	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3315	1938	0.846	0.846	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	716	1948	0.222	0.221	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2611	1941	0.691	0.690	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1282	1972	0.402	0.396	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2598	1983	0.684	0.669	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3053	1938	0.775	0.776	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3347	1939	0.850	0.850	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2635	1941	0.690	0.689	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3011	1937	0.768	0.769	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3206	1939	0.807	0.807	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3191	1943	0.805	0.803	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3354	1938	0.857	0.858	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1237	1992	0.397	0.387	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2566	1929	0.673	0.676	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3192	1942	0.808	0.807	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3185	1942	0.806	0.804	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.4e+02	12.9	AAA domain
2	PF19220 Crescentin	1.7e+02	12.6	Crescentin protein
3	PF00612 IQ	7e+02	11.5	IQ calmodulin-binding motif
4	PF00063 Myosin_head	7.2e-293	984.6	Myosin head (motor domain)
5	PF02736 Myosin_N	2.4e-12	57.7	Myosin N-terminal SH3-like domain
6	PF01576 Myosin_tail_1	1.4e-154	528.2	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379210	0.990	Myosin light chain 3
2	9606.ENSP00000354488	0.987	Troponin I, slow skeletal muscle
3	9606.ENSP00000442795	0.987	Myosin-binding protein C, cardiac-type
4	9606.ENSP00000228841	0.985	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
5	9606.ENSP00000290378	0.980	Actin, alpha cardiac muscle 1
6	9606.ENSP00000443495	0.977	Alpha-actinin-2
7	9606.ENSP00000307280	0.974	Myosin light chain 1/3, skeletal muscle isoform
8	9606.ENSP00000236918	0.973	Troponin T, cardiac muscle
9	9606.ENSP00000351022	0.973	Tropomyosin alpha-1 chain
10	9606.ENSP00000341838	0.969	Troponin I, cardiac muscle
11	9606.ENSP00000347055	0.960	Myosin light chain 4
12	9606.ENSP00000367542	0.953	Tropomyosin beta chain
13	9606.ENSP00000450385	0.952	Myosin light chain 6B
14	9606.ENSP00000279022	0.948	Myosin regulatory light polypeptide 9
15	9606.ENSP00000467141	0.947	Titin
16	9606.ENSP00000325239	0.937	Myosin light chain, phosphorylatable, fast skeletal muscle
17	9606.ENSP00000383023	0.933	Myosin light chain 5
18	9606.ENSP00000347507	0.932	Myosin-7
19	9606.ENSP00000464317	0.932	Myosin-3
20	9606.ENSP00000353590	0.927	Myosin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000146	1.000	microfilament motor activity
GO:0008092	0.891	cytoskeletal protein binding
GO:0003824	0.819	catalytic activity
GO:0016787	0.792	hydrolase activity
GO:0044877	0.641	protein-containing complex binding
GO:0097159	0.488	organic cyclic compound binding
GO:1901363	0.485	heterocyclic compound binding
GO:0003779	0.447	actin binding
GO:0140096	0.350	catalytic activity, acting on a protein
GO:0016791	0.345	phosphatase activity
GO:0004722	0.326	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003008	0.981	system process
GO:0009987	0.977	cellular process
GO:0003012	0.973	muscle system process
GO:0006936	0.962	muscle contraction
GO:0048856	0.951	anatomical structure development
GO:0031032	0.920	actomyosin structure organization
GO:0061061	0.914	muscle structure development
GO:0065007	0.895	biological regulation
GO:0050789	0.893	regulation of biological process
GO:0006941	0.883	striated muscle contraction
GO:0007275	0.835	multicellular organism development
GO:0055001	0.803	muscle cell development
GO:0048513	0.744	animal organ development
GO:0048731	0.726	system development
GO:0014706	0.703	striated muscle tissue development
GO:0031034	0.696	myosin filament assembly
GO:0009653	0.687	anatomical structure morphogenesis
GO:0051146	0.680	striated muscle cell differentiation
GO:0003009	0.649	skeletal muscle contraction
GO:0050896	0.634	response to stimulus
GO:0050794	0.630	regulation of cellular process
GO:0072359	0.567	circulatory system development
GO:0048646	0.498	anatomical structure formation involved in morphogenesis
GO:0007507	0.482	heart development
GO:0051239	0.427	regulation of multicellular organismal process
GO:0032989	0.384	cellular component morphogenesis
GO:0055002	0.382	striated muscle cell development
GO:0030239	0.369	myofibril assembly
GO:0048518	0.316	positive regulation of biological process
GO:0051716	0.306	cellular response to stimulus
GO:0071704	0.303	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0099512	0.998	supramolecular fiber
GO:0032991	0.996	protein-containing complex
GO:0015629	0.996	actin cytoskeleton
GO:0043292	0.990	contractile fiber
GO:0016459	0.967	myosin complex
GO:0016460	0.788	myosin II complex
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0005859	0.741	muscle myosin complex
GO:0005829	0.702	cytosol
GO:0030016	0.621	myofibril
GO:0030017	0.571	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	1.000	myosin ATPase.
EC:3.-.-.-	0.792	Hydrolases.
EC:3.1.3.-	0.345	Phosphoric monoester hydrolases.
EC:3.1.3.16	0.326	protein-serine/threonine phosphatase.

[back to server]