StarFunc result for job id P13535

User Input

>input (1937 residues)
MSASSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGG
KVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTY
SGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILIT
GESGAGKTVNTKRVIQYFATIAVTGEKKKDESGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKN
KDPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNK
LMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGD
FKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMR
DEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIK
PLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADS
LADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDL
ELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKV
NILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLD
EKLEKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRS
DLSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHA
DSMAELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVS
ELKTKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKH
QLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYET
DAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNA
ACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLET
LRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGK
ILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKK
MEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALRGQEDLKEQLAIVERR
ANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQL
QSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRL
DEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEED
RKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQV
NKLRVKSREVHTKISAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pa0A	0.340	0.657	0.000	974	0.323	0.643	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
2	AFDB:A0A0G2JY53	0.654	0.661	0.000	1915	0.546	0.552	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
3	AFDB:A0A0N4STT5	0.673	0.651	0.000	2008	0.788	0.760	A0A0N4STT5.pdb.gz
4	AFDB:A7E2Y1	0.695	0.680	0.000	1983	0.672	0.657	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
5	AFDB:B1AR69	0.692	0.692	0.000	1938	0.821	0.821	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
6	AFDB:B3DFS9	0.685	0.673	0.000	1974	0.400	0.392	B3DFS9.pdb.gz
7	AFDB:B8A568	0.757	0.757	0.000	1937	0.811	0.811	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
8	AFDB:B8JLS3	0.728	0.729	0.000	1936	0.766	0.766	B8JLS3.pdb.gz
9	AFDB:E7FD18	0.694	0.691	0.000	1945	0.725	0.722	E7FD18.pdb.gz
10	AFDB:F1R3G4	0.654	0.638	0.000	1992	0.391	0.380	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
11	AFDB:G3UW82	0.699	0.697	0.000	1942	0.929	0.927	G3UW82.pdb.gz	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
12	PDB:4pa0B	0.341	0.697	2.855E-102	920	0.315	0.664	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.340	0.674	1.132E-97	952	0.313	0.637	4p7hB.pdb.gz
14	PDB:5tbyA	0.372	0.721	3.198E-93	954	0.396	0.804	5tbyA.pdb.gz
15	PDB:7mf3B	0.367	0.769	6.116E-65	896	0.228	0.492	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.343	0.655	1.677E-59	995	0.137	0.267	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.364	0.822	3.066E-55	817	0.120	0.285	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.038	0.089	6.877E-2	529	0.035	0.129	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:3j9zLN	0.023	0.144	2.303E-1	272	0.005	0.037	3j9zLN.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
20	PDB:7wrgA	0.062	0.124	2.303E-1	812	0.039	0.094	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2097	1922	0.560	0.564	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3618	1912	0.919	0.931	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3622	1937	0.914	0.914	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3613	1939	0.914	0.913	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3088	1938	0.791	0.791	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A2AQP0	2529	1941	0.674	0.672	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
7	A6QLN6	1288	1972	0.403	0.396	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
8	A7E2Y1	2535	1983	0.673	0.658	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
9	B1AR69	3232	1938	0.820	0.819	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
10	B6IDE1	3122	1939	0.790	0.789	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
11	B6RK61	2553	1941	0.671	0.670	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
12	B8A568	3161	1937	0.812	0.812	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
13	F1LMU0	3603	1939	0.910	0.909	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
14	F1LRV9	3622	1943	0.920	0.918	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
15	F1QZW1	3117	1938	0.790	0.790	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
16	F1R3G4	1236	1992	0.395	0.384	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
17	F7F0L5	2493	1929	0.658	0.660	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
18	G3UW82	3643	1942	0.926	0.923	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
19	G3V6E1	3645	1942	0.927	0.924	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4
20	G3V9Y1	1248	1986	0.399	0.389	G3V9Y1_RAT Myosin heavy chain 10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.7e+02	12.8	AAA domain
2	PF19220 Crescentin	45	14.6	Crescentin protein
3	PF00612 IQ	34	15.6	IQ calmodulin-binding motif
4	PF00063 Myosin_head	3.4e-282	949.4	Myosin head (motor domain)
5	PF02736 Myosin_N	1.1e-10	52.3	Myosin N-terminal SH3-like domain
6	PF01576 Myosin_tail_1	4e-156	533.4	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.977	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000450385	0.963	Myosin light chain 6B
3	9606.ENSP00000279022	0.953	Myosin regulatory light polypeptide 9
4	9606.ENSP00000325239	0.953	Myosin light chain, phosphorylatable, fast skeletal muscle
5	9606.ENSP00000383023	0.947	Myosin light chain 5
6	9606.ENSP00000379210	0.945	Myosin light chain 3
7	9606.ENSP00000443495	0.939	Alpha-actinin-2
8	9606.ENSP00000351022	0.937	Tropomyosin alpha-1 chain
9	9606.ENSP00000404570	0.935	Myosin-13
10	9606.ENSP00000226207	0.933	Myosin-1
11	9606.ENSP00000245503	0.929	Myosin-2
12	9606.ENSP00000353590	0.924	Myosin-10
13	9606.ENSP00000347055	0.919	Myosin light chain 4
14	9606.ENSP00000347507	0.919	Myosin-7
15	9606.ENSP00000464317	0.919	Myosin-3
16	9606.ENSP00000386041	0.918	Myosin-6
17	9606.ENSP00000228841	0.917	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
18	9606.ENSP00000470298	0.914	Myosin-14
19	9606.ENSP00000463559	0.904	Myosin regulatory light chain 12B
20	9606.ENSP00000216181	0.901	Myosin-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000146	0.999	microfilament motor activity
GO:0008092	0.928	cytoskeletal protein binding
GO:0003779	0.843	actin binding
GO:0044877	0.827	protein-containing complex binding
GO:0016787	0.480	hydrolase activity
GO:0051015	0.376	actin filament binding
GO:0097159	0.364	organic cyclic compound binding
GO:1901363	0.359	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0003012	0.982	muscle system process
GO:0006936	0.951	muscle contraction
GO:0030029	0.933	actin filament-based process
GO:0006941	0.925	striated muscle contraction
GO:0016043	0.916	cellular component organization
GO:0097435	0.795	supramolecular fiber organization
GO:0050896	0.793	response to stimulus
GO:0030036	0.789	actin cytoskeleton organization
GO:0031034	0.775	myosin filament assembly
GO:0032502	0.761	developmental process
GO:0048856	0.713	anatomical structure development
GO:0065007	0.684	biological regulation
GO:0050789	0.656	regulation of biological process
GO:0061061	0.372	muscle structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.999	contractile fiber
GO:0032991	0.998	protein-containing complex
GO:0015629	0.998	actin cytoskeleton
GO:0016459	0.967	myosin complex
GO:0005829	0.920	cytosol
GO:0030016	0.799	myofibril
GO:0005859	0.660	muscle myosin complex
GO:0043227	0.629	membrane-bounded organelle
GO:0030017	0.408	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.999	myosin ATPase.
EC:3.-.-.-	0.480	Hydrolases.

[back to server]