StarFunc result for job id P13569

User Input

>input (1480 residues)
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRE
LASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGL
GRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA
YVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQT
WYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEG
KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV
LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNS
ILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQ
MNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQG
QNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN
NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAP
MSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATV
PVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHK
ALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIM
STLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK
DDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL
LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVAD
EVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVT
YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQA
ISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5uakA	0.652	0.826	0.000	1139	0.765	0.994	5uakA.pdb.gz	Molecular Structure of the Human CFTR Ion Channel.
2	PDB:5w81A	0.765	0.960	0.000	1173	0.483	0.610	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
3	PDB:6msmA	0.781	0.975	0.000	1181	0.797	0.999	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
4	AFDB:P13569	1.000	1.000	0.000	1480	1.000	1.000	P13569.pdb.gz	CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens OX=9606 GN=CFTR PE=1 SV=3
5	AFDB:P26361	0.898	0.900	0.000	1476	0.784	0.786	P26361.pdb.gz	CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus OX=10090 GN=Cftr PE=1 SV=2
6	AFDB:Q1LX78	0.842	0.839	0.000	1485	0.557	0.555	Q1LX78.pdb.gz	CFTR_DANRE Cystic fibrosis transmembrane conductance regulator OS=Danio rerio OX=7955 GN=cftr PE=1 SV=1
7	PDB:5uarA	0.676	0.826	4.217E-100	1184	0.487	0.609	5uarA.pdb.gz
8	AFDB:O15439	0.701	0.775	1.350E-89	1325	0.304	0.340	O15439.pdb.gz	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
9	AFDB:A0A2R8Q6E0	0.703	0.777	1.272E-88	1327	0.295	0.329	A0A2R8Q6E0.pdb.gz
10	AFDB:E9Q236	0.713	0.789	7.144E-88	1325	0.303	0.339	E9Q236.pdb.gz	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
11	AFDB:Q9VGM1	0.702	0.782	5.880E-84	1316	0.270	0.303	Q9VGM1.pdb.gz	Q9VGM1_DROME Multidrug resistance protein 4 OS=Drosophila melanogaster OX=7227 GN=Mrp4 PE=1 SV=2
12	AFDB:Q9W2I5	0.722	0.807	1.747E-81	1312	0.251	0.284	Q9W2I5.pdb.gz	Q9W2I5_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10505 PE=4 SV=2
13	AFDB:Q54P13	0.695	0.650	4.712E-81	1593	0.272	0.252	Q54P13.pdb.gz	ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum OX=44689 GN=abcC8 PE=3 SV=1
14	AFDB:Q7KTC0	0.712	0.683	2.042E-80	1549	0.241	0.230	Q7KTC0.pdb.gz	Q7KTC0_DROME Multidrug-Resistance like protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
15	PDB:7vluA	0.690	0.867	3.570E-66	1159	0.217	0.277	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
16	PDB:6jb1B	0.637	0.685	3.512E-65	1366	0.212	0.230	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
17	PDB:7mpeA	0.580	0.597	1.175E-64	1428	0.254	0.263	7mpeA.pdb.gz
18	PDB:5ykfB	0.625	0.698	1.352E-62	1309	0.211	0.239	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
19	PDB:7s5xE	0.696	0.728	1.878E-61	1412	0.216	0.227	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
20	PDB:6c3pE	0.689	0.747	8.009E-60	1359	0.215	0.234	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13569	0.0	3046	1480	1.000	1.000	CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens OX=9606 GN=CFTR PE=1 SV=3
2	P26361	0.0	2340	1476	0.785	0.787	CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus OX=10090 GN=Cftr PE=1 SV=2
3	P34158	0.0	2281	1476	0.780	0.782	CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus OX=10116 GN=Cftr PE=1 SV=3
4	Q1LX78	0.0	1702	1485	0.563	0.561	CFTR_DANRE Cystic fibrosis transmembrane conductance regulator OS=Danio rerio OX=7955 GN=cftr PE=1 SV=1
5	Q8QFL6	5.39e-125	424	1327	0.152	0.170	Q8QFL6_DANRE Cystic fibrosis transmembrane conductance regulator OS=Danio rerio OX=7955 GN=dZ52I16.4 PE=1 SV=2
6	E9Q236	2.70e-124	422	1325	0.158	0.177	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
7	O15439	1.52e-123	421	1325	0.151	0.168	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
8	F1M3J4	7.10e-121	413	1325	0.149	0.167	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
9	F1LR52	9.21e-119	406	1288	0.151	0.174	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
10	Q9VGM1	3.58e-107	374	1316	0.149	0.167	Q9VGM1_DROME Multidrug resistance protein 4 OS=Drosophila melanogaster OX=7227 GN=Mrp4 PE=1 SV=2
11	A0A0B4KGI0	1.49e-105	370	1408	0.148	0.156	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
12	Q9VLN6	2.17e-100	354	1355	0.143	0.156	Q9VLN6_DROME FI20146p1 OS=Drosophila melanogaster OX=7227 GN=Dme_CG7627 PE=1 SV=2
13	P91660	3.55e-100	354	1374	0.136	0.147	L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster OX=7227 GN=l(2)03659 PE=2 SV=4
14	Q8T9B4	2.69e-94	330	985	0.110	0.165	Q8T9B4_DROME SD08921p OS=Drosophila melanogaster OX=7227 GN=CG7627 PE=2 SV=1
15	Q9W2I5	2.62e-93	333	1312	0.137	0.155	Q9W2I5_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10505 PE=4 SV=2
16	Q10185	9.76e-85	308	1478	0.118	0.118	ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc2 PE=1 SV=1
17	Q9P5N0	6.26e-84	305	1465	0.136	0.137	ABC3_SCHPO Vacuolar heme ABC transmembrane exporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc3 PE=1 SV=1
18	Q3S1M2	1.55e-83	305	1534	0.118	0.113	Q3S1M2_CAEEL Multidrug resistance-associated protein lethal(2)03659 OS=Caenorhabditis elegans OX=6239 GN=mrp-1 PE=1 SV=1
19	Q9QYM0	2.72e-83	303	1436	0.122	0.125	MRP5_RAT ATP-binding cassette sub-family C member 5 OS=Rattus norvegicus OX=10116 GN=Abcc5 PE=2 SV=2
20	O15440	2.88e-83	303	1437	0.122	0.126	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.54	22.1	AAA ATPase domain
2	PF13245 AAA_19	30	16.3	AAA domain
3	PF13304 AAA_21	0.0003	32.3	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	36	16.1	AAA domain
5	PF13479 AAA_24	6e+02	11.5	AAA domain
6	PF13481 AAA_25	2.4e+02	12.7	AAA domain
7	PF13555 AAA_29	0.0073	27.4	P-loop containing region of AAA domain
8	PF13604 AAA_30	8.5	17.6	AAA domain
9	PF12775 AAA_7	2.4e+02	12.7	P-loop containing dynein motor region
10	PF00664 ABC_membrane	1.5e-88	308.6	ABC transporter transmembrane region
11	PF00005 ABC_tran	1.1e-55	199.3	ABC transporter
12	PF14396 CFTR_R	2.2e-92	320.0	Cystic fibrosis TM conductance regulator (CFTR), regulator domain
13	PF02492 cobW	2.8e+02	12.5	CobW/HypB/UreG, nucleotide-binding domain
14	PF19993 DO-GTPase2	2.5	19.3	Double-GTPase 2
15	PF01935 DUF87	0.24	23.0	Helicase HerA, central domain
16	PF01580 FtsK_SpoIIIE	67	14.3	FtsK/SpoIIIE family
17	PF14890 Intein_splicing	3.7e+02	12.3	Intein splicing domain
18	PF03308 MeaB	4.4	17.8	Methylmalonyl Co-A mutase-associated GTPase MeaB
19	PF01926 MMR_HSR1	2.1	19.8	50S ribosome-binding GTPase
20	PF03205 MobB	1.6e+02	13.5	Molybdopterin guanine dinucleotide synthesis protein B

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000003084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262613	0.999	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
2	9606.ENSP00000335153	0.998	Heat shock protein HSP 90-alpha
3	9606.ENSP00000408005	0.998	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
4	9606.ENSP00000432083	0.998	Heat shock cognate 71 kDa protein
5	9606.ENSP00000302961	0.997	Heat shock protein family A member 4
6	9606.ENSP00000356042	0.997	Ezrin
7	9606.ENSP00000357484	0.996	Golgi-associated PDZ and coiled-coil motif-containing protein
8	9606.ENSP00000394485	0.996	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
9	9606.ENSP00000247461	0.995	Calnexin
10	9606.ENSP00000305372	0.993	Beta-2 adrenergic receptor
11	9606.ENSP00000378920	0.993	Solute carrier family 26 member 6
12	9606.ENSP00000351777	0.989	Transitional endoplasmic reticulum ATPase
13	9606.ENSP00000345873	0.980	Chloride anion exchanger
14	9606.ENSP00000219548	0.978	E3 ubiquitin-protein ligase CHIP
15	9606.ENSP00000364235	0.976	E3 ubiquitin-protein ligase RNF5
16	9606.ENSP00000264639	0.961	26S proteasome non-ATPase regulatory subunit 3
17	9606.ENSP00000346148	0.960	5'-AMP-activated protein kinase catalytic subunit alpha-1
18	9606.ENSP00000222812	0.953	Syntaxin-1A
19	9606.ENSP00000281537	0.953	Tight junction protein ZO-1
20	9606.ENSP00000457411	0.953	Ubiquitin carboxyl-terminal hydrolase 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140657	0.998	ATP-dependent activity
GO:0005254	0.998	chloride channel activity
GO:0008514	0.996	organic anion transmembrane transporter activity
GO:0022804	0.979	active transmembrane transporter activity
GO:0015106	0.972	bicarbonate transmembrane transporter activity
GO:0042626	0.960	ATPase-coupled transmembrane transporter activity
GO:0036094	0.892	small molecule binding
GO:0043168	0.892	anion binding
GO:0097367	0.890	carbohydrate derivative binding
GO:1901363	0.886	heterocyclic compound binding
GO:0035639	0.876	purine ribonucleoside triphosphate binding
GO:0032555	0.876	purine ribonucleotide binding
GO:0003824	0.873	catalytic activity
GO:0016247	0.856	channel regulator activity
GO:0099106	0.852	ion channel regulator activity
GO:0008200	0.830	ion channel inhibitor activity
GO:0016787	0.811	hydrolase activity
GO:0099095	0.800	ligand-gated monoatomic anion channel activity
GO:0017111	0.798	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.789	ATP hydrolysis activity
GO:0035381	0.772	ATP-gated ion channel activity
GO:0019904	0.766	protein domain specific binding
GO:0030165	0.724	PDZ domain binding
GO:0032559	0.563	adenyl ribonucleotide binding
GO:0005524	0.546	ATP binding
GO:0019899	0.483	enzyme binding
GO:0005217	0.472	intracellular ligand-gated monoatomic ion channel activity
GO:0043225	0.443	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0019869	0.409	chloride channel inhibitor activity
GO:0051087	0.388	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.994	localization
GO:0009987	0.992	cellular process
GO:0065007	0.989	biological regulation
GO:0050789	0.980	regulation of biological process
GO:0050896	0.963	response to stimulus
GO:0050794	0.958	regulation of cellular process
GO:0051234	0.945	establishment of localization
GO:0006810	0.932	transport
GO:0006811	0.876	monoatomic ion transport
GO:0055085	0.808	transmembrane transport
GO:0051716	0.637	cellular response to stimulus
GO:0042221	0.628	response to chemical
GO:0071704	0.520	organic substance metabolic process
GO:0048518	0.480	positive regulation of biological process
GO:0048522	0.451	positive regulation of cellular process
GO:0044238	0.417	primary metabolic process
GO:0070887	0.404	cellular response to chemical stimulus
GO:0032501	0.384	multicellular organismal process
GO:0071702	0.361	organic substance transport
GO:0010033	0.332	response to organic substance
GO:0048519	0.316	negative regulation of biological process
GO:0032879	0.313	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0098590	0.987	plasma membrane region
GO:0016324	0.975	apical plasma membrane
GO:0005829	0.969	cytosol
GO:0043226	0.956	organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0012505	0.796	endomembrane system
GO:0031982	0.678	vesicle
GO:0031090	0.593	organelle membrane
GO:0032991	0.482	protein-containing complex
GO:0097708	0.436	intracellular vesicle
GO:0031410	0.422	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.998	chloride(in) = chloride(out)
RHEA:28695	0.972	hydrogencarbonate(in) = hydrogencarbonate(out)
EC:7.-.-.-	0.960	Translocases.
EC:3.-.-.-	0.811	Hydrolases.
RHEA:23680	0.798	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.798	nucleoside-triphosphate phosphatase.
RHEA:13065	0.789	ATP + H2O = ADP + H(+) + phosphate

[back to server]