StarFunc result for job id P13598

User Input

>input (275 residues)
MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGL
ETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQ
PTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTAD
REDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVT
SVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13598	1.000	1.000	4.634E-50	275	1.000	1.000	P13598.pdb.gz	ICAM2_HUMAN Intercellular adhesion molecule 2 OS=Homo sapiens OX=9606 GN=ICAM2 PE=1 SV=2
2	AFDB:P35330	0.715	0.710	3.645E-30	277	0.593	0.588	P35330.pdb.gz	ICAM2_MOUSE Intercellular adhesion molecule 2 OS=Mus musculus OX=10090 GN=Icam2 PE=1 SV=1
3	AFDB:P32942	0.638	0.337	1.452E-18	547	0.276	0.139	P32942.pdb.gz	ICAM3_HUMAN Intercellular adhesion molecule 3 OS=Homo sapiens OX=9606 GN=ICAM3 PE=1 SV=2
4	AFDB:Q60625	0.597	0.201	2.222E-18	917	0.276	0.083	Q60625.pdb.gz	ICAM5_MOUSE Intercellular adhesion molecule 5 OS=Mus musculus OX=10090 GN=Icam5 PE=1 SV=2
5	AFDB:Q14773	0.635	0.643	3.224E-18	271	0.225	0.229	Q14773.pdb.gz	ICAM4_HUMAN Intercellular adhesion molecule 4 OS=Homo sapiens OX=9606 GN=ICAM4 PE=1 SV=1
6	AFDB:Q9UMF0	0.577	0.194	3.782E-18	924	0.284	0.084	Q9UMF0.pdb.gz	ICAM5_HUMAN Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3
7	AFDB:P05362	0.605	0.332	3.351E-17	532	0.258	0.133	P05362.pdb.gz	ICAM1_HUMAN Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2
8	AFDB:P13597	0.620	0.335	1.744E-16	537	0.236	0.121	P13597.pdb.gz	ICAM1_MOUSE Intercellular adhesion molecule 1 OS=Mus musculus OX=10090 GN=Icam1 PE=1 SV=1
9	AFDB:Q00238	0.632	0.335	3.874E-16	545	0.236	0.119	Q00238.pdb.gz	ICAM1_RAT Intercellular adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Icam1 PE=2 SV=1
10	AFDB:P29533	0.504	0.215	8.558E-12	739	0.153	0.057	P29533.pdb.gz	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
11	PDB:7bg7B	0.287	0.901	1.061E-6	84	0.102	0.333	7bg7B.pdb.gz
12	PDB:5c6wJ	0.248	0.280	6.140E-6	238	0.120	0.139	5c6wJ.pdb.gz
13	PDB:6dlfA	0.435	0.496	7.203E-6	236	0.091	0.106	6dlfA.pdb.gz
14	PDB:3o3uN	0.384	0.203	1.600E-5	580	0.113	0.053	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
15	PDB:7u7nC	0.255	0.317	1.600E-5	200	0.105	0.145	7u7nC.pdb.gz
16	PDB:1fj1A	0.320	0.390	2.583E-5	213	0.080	0.103	1fj1A.pdb.gz
17	PDB:5c7kF	0.277	0.337	3.030E-5	212	0.073	0.094	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
18	PDB:1ct8A	0.264	0.316	3.196E-5	214	0.098	0.126	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
19	PDB:1kcsL	0.283	0.342	3.554E-5	214	0.091	0.117	1kcsL.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
20	PDB:1f11A	0.317	0.380	3.749E-5	216	0.065	0.083	1f11A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13598	0.0	573	275	1.000	1.000	ICAM2_HUMAN Intercellular adhesion molecule 2 OS=Homo sapiens OX=9606 GN=ICAM2 PE=1 SV=2
2	P35330	3.72e-103	303	277	0.600	0.596	ICAM2_MOUSE Intercellular adhesion molecule 2 OS=Mus musculus OX=10090 GN=Icam2 PE=1 SV=1
3	P32942	7.44e-30	119	547	0.280	0.141	ICAM3_HUMAN Intercellular adhesion molecule 3 OS=Homo sapiens OX=9606 GN=ICAM3 PE=1 SV=2
4	Q60625	7.58e-30	120	917	0.291	0.087	ICAM5_MOUSE Intercellular adhesion molecule 5 OS=Mus musculus OX=10090 GN=Icam5 PE=1 SV=2
5	Q9UMF0	1.02e-28	117	924	0.269	0.080	ICAM5_HUMAN Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3
6	P13597	1.43e-23	101	537	0.247	0.127	ICAM1_MOUSE Intercellular adhesion molecule 1 OS=Mus musculus OX=10090 GN=Icam1 PE=1 SV=1
7	P05362	2.25e-23	101	532	0.258	0.133	ICAM1_HUMAN Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2
8	Q5NKV8	2.39e-23	101	532	0.258	0.133	Q5NKV8_HUMAN Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=2 SV=1
9	Q00238	1.86e-22	98.6	545	0.229	0.116	ICAM1_RAT Intercellular adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Icam1 PE=2 SV=1
10	Q14773	8.56e-17	80.1	271	0.218	0.221	ICAM4_HUMAN Intercellular adhesion molecule 4 OS=Homo sapiens OX=9606 GN=ICAM4 PE=1 SV=1
11	P29533	7.72e-05	46.2	739	0.167	0.062	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
12	B8JHX2	9.60e-05	45.4	360	0.127	0.097	B8JHX2_DANRE Intercellular adhesion molecule 3 OS=Danio rerio OX=7955 GN=si:ch211-74m13.3 PE=3 SV=1
13	P29534	4.91e-04	43.9	739	0.178	0.066	VCAM1_RAT Vascular cell adhesion protein 1 OS=Rattus norvegicus OX=10116 GN=Vcam1 PE=1 SV=1
14	P19320	6.42e-04	43.5	739	0.091	0.034	VCAM1_HUMAN Vascular cell adhesion protein 1 OS=Homo sapiens OX=9606 GN=VCAM1 PE=1 SV=1
15	F6NRL9	0.001	42.4	440	0.167	0.105	F6NRL9_DANRE Vascular cell adhesion molecule 1a OS=Danio rerio OX=7955 GN=vcam1a PE=4 SV=1
16	A4JYI2	0.009	39.7	808	0.098	0.033	A4JYI2_DANRE Vascular cell adhesion protein 1 precursor OS=Danio rerio OX=7955 GN=zgc:158875 PE=2 SV=1
17	A5PMX0	0.011	39.7	808	0.098	0.033	A5PMX0_DANRE Vascular cell adhesion molecule 1b OS=Danio rerio OX=7955 GN=fi76d06 PE=4 SV=1
18	O70540	0.030	37.7	394	0.131	0.091	MADCA_RAT Mucosal addressin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Madcam1 PE=2 SV=1
19	Q0KI85	0.18	35.8	1087	0.153	0.039	Q0KI85_DROME Sidestep VI, isoform B OS=Drosophila melanogaster OX=7227 GN=side-VI PE=1 SV=1
20	P04211	0.81	32.0	117	0.051	0.120	LV743_HUMAN Immunoglobulin lambda variable 7-43 OS=Homo sapiens OX=9606 GN=IGLV7-43 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03921 ICAM_N	6.9e-38	139.6	Intercellular adhesion molecule (ICAM), N-terminal domain
2	PF00047 ig	3.5e+02	12.8	Immunoglobulin domain
3	PF13895 Ig_2	63	15.3	Immunoglobulin domain
4	PF13927 Ig_3	4.7e+02	12.8	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415283

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315477	0.998	CD209 antigen
2	9606.ENSP00000349252	0.998	Integrin alpha-L
3	9606.ENSP00000384136	0.997	Radixin
4	9606.ENSP00000380948	0.986	Integrin beta-2
5	9606.ENSP00000441691	0.981	Integrin alpha-M
6	9606.ENSP00000356042	0.932	Ezrin
7	9606.ENSP00000264832	0.855	Intercellular adhesion molecule 1
8	9606.ENSP00000160262	0.843	Intercellular adhesion molecule 3
9	9606.ENSP00000294728	0.759	Vascular cell adhesion protein 1
10	9606.ENSP00000457421	0.750	Platelet endothelial cell adhesion molecule
11	9606.ENSP00000353408	0.736	Moesin
12	9606.ENSP00000263686	0.702	P-selectin
13	9606.ENSP00000316228	0.691	C-type lectin domain family 4 member M
14	9606.ENSP00000331736	0.690	E-selectin
15	9606.ENSP00000236147	0.681	L-selectin
16	9606.ENSP00000362680	0.674	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000264072	0.663	Low affinity immunoglobulin epsilon Fc receptor
18	9606.ENSP00000161559	0.657	Carcinoembryonic antigen-related cell adhesion molecule 1
19	9606.ENSP00000344115	0.631	Cadherin-5
20	9606.ENSP00000215637	0.620	Mucosal addressin cell adhesion molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	1.000	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0050896	0.980	response to stimulus
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.967	positive regulation of cellular process
GO:0010033	0.966	response to organic substance
GO:0070887	0.949	cellular response to chemical stimulus
GO:0002682	0.933	regulation of immune system process
GO:0051239	0.915	regulation of multicellular organismal process
GO:0032502	0.910	developmental process
GO:0048856	0.894	anatomical structure development
GO:0019222	0.863	regulation of metabolic process
GO:0050865	0.862	regulation of cell activation
GO:0007155	0.857	cell adhesion
GO:0060255	0.827	regulation of macromolecule metabolic process
GO:0048583	0.816	regulation of response to stimulus
GO:0048519	0.816	negative regulation of biological process
GO:0032501	0.798	multicellular organismal process
GO:0048523	0.770	negative regulation of cellular process
GO:0030155	0.748	regulation of cell adhesion
GO:0007154	0.742	cell communication
GO:0009893	0.723	positive regulation of metabolic process
GO:0023052	0.704	signaling
GO:0023051	0.704	regulation of signaling
GO:0010646	0.704	regulation of cell communication
GO:0002376	0.696	immune system process
GO:0051240	0.681	positive regulation of multicellular organismal process
GO:0007165	0.583	signal transduction
GO:0040012	0.572	regulation of locomotion
GO:2000145	0.558	regulation of cell motility
GO:0009966	0.558	regulation of signal transduction
GO:0010468	0.544	regulation of gene expression
GO:0098609	0.539	cell-cell adhesion
GO:0022407	0.533	regulation of cell-cell adhesion
GO:0002684	0.522	positive regulation of immune system process
GO:0030334	0.511	regulation of cell migration
GO:0010604	0.509	positive regulation of macromolecule metabolic process
GO:0071310	0.499	cellular response to organic substance
GO:0080090	0.490	regulation of primary metabolic process
GO:0051171	0.490	regulation of nitrogen compound metabolic process
GO:0048584	0.490	positive regulation of response to stimulus
GO:0010941	0.483	regulation of cell death
GO:0050900	0.481	leukocyte migration
GO:0031323	0.475	regulation of cellular metabolic process
GO:0006950	0.465	response to stress
GO:0042127	0.465	regulation of cell population proliferation
GO:1901700	0.461	response to oxygen-containing compound
GO:0051179	0.457	localization
GO:0051246	0.451	regulation of protein metabolic process
GO:0030154	0.446	cell differentiation
GO:0030335	0.439	positive regulation of cell migration
GO:0051173	0.422	positive regulation of nitrogen compound metabolic process
GO:0009605	0.406	response to external stimulus
GO:0010647	0.383	positive regulation of cell communication
GO:0023056	0.382	positive regulation of signaling
GO:0007275	0.380	multicellular organism development
GO:0031325	0.375	positive regulation of cellular metabolic process
GO:0065009	0.370	regulation of molecular function
GO:0050793	0.366	regulation of developmental process
GO:0007166	0.355	cell surface receptor signaling pathway
GO:0019220	0.350	regulation of phosphate metabolic process
GO:0009967	0.350	positive regulation of signal transduction
GO:0043067	0.337	regulation of programmed cell death
GO:1902531	0.332	regulation of intracellular signal transduction
GO:0006955	0.330	immune response
GO:0071840	0.327	cellular component organization or biogenesis
GO:0007159	0.323	leukocyte cell-cell adhesion
GO:0051241	0.321	negative regulation of multicellular organismal process
GO:0042325	0.311	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0098590	0.974	plasma membrane region
GO:0005576	0.884	extracellular region
GO:0005615	0.854	extracellular space
GO:0032153	0.661	cell division site
GO:0043227	0.572	membrane-bounded organelle
GO:0031982	0.482	vesicle
GO:0043231	0.385	intracellular membrane-bounded organelle
GO:0005737	0.324	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]