StarFunc result for job id P13611

User Input

>input (1400 residues)
MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLA
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVED
KQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVS
ELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESV
SASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSG
DKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEV
FSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYD
ENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDS
TTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSST
QEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPET
MRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDEL
LTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKY
ETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIK
VTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHP
DINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIE
IDLYHSEENEEEEEECANAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86W61	0.240	0.934	5.097E-67	354	0.249	0.983	Q86W61.pdb.gz	Q86W61_HUMAN VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1
2	AFDB:A0A2R8QK78	0.227	0.203	1.329E-50	1570	0.260	0.232	A0A2R8QK78.pdb.gz
3	AFDB:P55066	0.234	0.257	5.689E-46	1268	0.195	0.215	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
4	AFDB:F1QDA1	0.218	0.198	3.396E-45	1547	0.229	0.207	F1QDA1.pdb.gz	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
5	AFDB:O14594	0.232	0.246	5.021E-45	1321	0.204	0.217	O14594.pdb.gz	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
6	AFDB:P13608	0.219	0.132	2.178E-41	2364	0.264	0.157	P13608.pdb.gz	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
7	PDB:3oaiA	0.073	0.199	1.938E-7	488	0.021	0.059	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
8	PDB:4adfM	0.072	0.442	9.253E-7	191	0.019	0.136	4adfM.pdb.gz
9	PDB:5c6wJ	0.064	0.334	1.887E-5	238	0.024	0.139	5c6wJ.pdb.gz
10	PDB:6dldD	0.068	0.318	1.887E-5	269	0.015	0.078	6dldD.pdb.gz
11	PDB:7qpdT	0.073	0.261	2.110E-5	348	0.016	0.066	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
12	PDB:6jxrm	0.069	0.320	3.298E-5	248	0.023	0.129	6jxrm.pdb.gz
13	PDB:1aqkL	0.066	0.373	3.687E-5	216	0.022	0.144	1aqkL.pdb.gz
14	PDB:1jnhA	0.065	0.371	3.687E-5	208	0.020	0.135	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
15	PDB:3c2aL	0.066	0.380	4.123E-5	216	0.021	0.139	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
16	PDB:2qhrL	0.066	0.361	5.155E-5	218	0.019	0.124	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
17	AFDB:Q967D7	0.076	0.070	2.744E-4	1531	0.122	0.112	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
18	AFDB:Q4ZHG4	0.059	0.046	9.911E-4	1894	0.128	0.095	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
19	AFDB:Q2Q0I9	0.057	0.048	1.048E-3	1779	0.135	0.106	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
20	AFDB:A0A2R8QRK0	0.046	0.046	2.166E-3	1420	0.088	0.087	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SX59	0.0	2042	3382	0.769	0.318	F1SX59_PIG Versican OS=Sus scrofa OX=9823 GN=VCAN PE=2 SV=1
2	P13611	0.0	2844	3396	1.000	0.412	CSPG2_HUMAN Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3
3	Q62059	0.0	1709	3357	0.664	0.277	CSPG2_MOUSE Versican core protein OS=Mus musculus OX=10090 GN=Vcan PE=1 SV=2
4	Q86W61	0.0	751	354	0.249	0.983	Q86W61_HUMAN VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1
5	Q9ERB4	0.0	696	2738	0.219	0.112	CSPG2_RAT Versican core protein (Fragments) OS=Rattus norvegicus OX=10116 GN=Vcan PE=2 SV=2
6	A0A2R8Q3K1	3.31e-137	437	635	0.147	0.324	A0A2R8Q3K1_DANRE Chondroitin sulfate proteoglycan 2 OS=Danio rerio OX=7955 GN=br146 PE=4 SV=1
7	Q75ZI3	1.03e-122	421	1570	0.140	0.125	Q75ZI3_DANRE Dermacan OS=Danio rerio OX=7955 GN=dcan PE=1 SV=1
8	Q29011	1.03e-114	373	537	0.122	0.318	PGCA_PIG Aggrecan core protein (Fragments) OS=Sus scrofa OX=9823 GN=ACAN PE=1 SV=3
9	P16112	1.39e-106	377	2530	0.127	0.070	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
10	P07897	2.17e-106	376	2124	0.124	0.082	PGCA_RAT Aggrecan core protein OS=Rattus norvegicus OX=10116 GN=Acan PE=1 SV=2
11	Q61282	5.42e-106	375	2132	0.124	0.082	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
12	P13608	6.46e-105	372	2364	0.121	0.071	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
13	E7F537	1.42e-103	364	1509	0.123	0.114	E7F537_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=3
14	F1QDA1	1.83e-103	365	1547	0.123	0.111	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
15	P55066	2.77e-102	357	1268	0.126	0.139	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
16	P55067	8.10e-102	356	1257	0.133	0.148	NCAN_RAT Neurocan core protein OS=Rattus norvegicus OX=10116 GN=Ncan PE=1 SV=1
17	A4JYN2	2.56e-100	352	1295	0.114	0.124	A4JYN2_DANRE Bcan OS=Danio rerio OX=7955 GN=fi32a12 PE=1 SV=1
18	O14594	3.82e-99	349	1321	0.121	0.129	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
19	P55068	6.34e-99	340	883	0.111	0.177	PGCB_RAT Brevican core protein OS=Rattus norvegicus OX=10116 GN=Bcan PE=1 SV=2
20	Q96GW7	6.30e-97	335	911	0.108	0.166	PGCB_HUMAN Brevican core protein OS=Homo sapiens OX=9606 GN=BCAN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.6e+02	13.1	Immunoglobulin I-set domain
2	PF00047 ig	1.3e+02	14.1	Immunoglobulin domain
3	PF07686 V-set	7.8e-15	66.4	Immunoglobulin V-set domain
4	PF00193 Xlink	6.5e-61	214.0	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260010	0.998	Toll-like receptor 2
2	9606.ENSP00000398632	0.993	CD44 antigen
3	9606.ENSP00000346839	0.972	Fibronectin type III domain containing
4	9606.ENSP00000331544	0.969	Fibulin-1
5	9606.ENSP00000236147	0.965	L-selectin
6	9606.ENSP00000389600	0.965	Toll-like receptor 6
7	9606.ENSP00000325527	0.959	Fibrillin-1
8	9606.ENSP00000264039	0.955	Glypican-1
9	9606.ENSP00000361818	0.953	Syndecan-4
10	9606.ENSP00000370542	0.952	Syndecan-1
11	9606.ENSP00000368678	0.950	Agrin
12	9606.ENSP00000292377	0.946	Glypican-2
13	9606.ENSP00000366246	0.945	Glypican-6
14	9606.ENSP00000359864	0.944	Glypican-4
15	9606.ENSP00000363827	0.943	Basement membrane-specific heparan sulfate proteoglycan core protein
16	9606.ENSP00000305725	0.941	Carbohydrate sulfotransferase 11
17	9606.ENSP00000307046	0.940	Syndecan-2
18	9606.ENSP00000366267	0.939	Glypican-5
19	9606.ENSP00000377836	0.939	Glypican-3
20	9606.ENSP00000344468	0.938	Syndecan-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005539	0.998	glycosaminoglycan binding
GO:0005540	0.992	hyaluronic acid binding
GO:0019899	0.587	enzyme binding
GO:0019902	0.526	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.985	anatomical structure development
GO:0032501	0.981	multicellular organismal process
GO:0009987	0.962	cellular process
GO:0048731	0.915	system development
GO:0007399	0.615	nervous system development
GO:0030154	0.536	cell differentiation
GO:0022008	0.533	neurogenesis
GO:0007155	0.409	cell adhesion
GO:0065007	0.367	biological regulation
GO:0050789	0.346	regulation of biological process
GO:0050794	0.338	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.996	collagen-containing extracellular matrix
GO:0012505	0.938	endomembrane system
GO:0070013	0.880	intracellular organelle lumen
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0005576	0.735	extracellular region
GO:0005737	0.730	cytoplasm
GO:0005615	0.545	extracellular space
GO:0005794	0.544	Golgi apparatus
GO:0016020	0.510	membrane
GO:0000323	0.497	lytic vacuole
GO:0005764	0.481	lysosome
GO:0005796	0.421	Golgi lumen
GO:0043202	0.420	lysosomal lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]