StarFunc result for job id P13631

User Input

>input (454 residues)
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZF61	0.594	0.589	1.553E-60	458	0.969	0.961	D3ZF61.pdb.gz	D3ZF61_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
2	AFDB:D3ZWV0	0.832	0.781	4.688E-56	485	0.866	0.810	D3ZWV0.pdb.gz	D3ZWV0_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
3	AFDB:Q91392	0.807	0.738	2.418E-51	499	0.771	0.701	Q91392.pdb.gz	RARGA_DANRE Retinoic acid receptor gamma-A OS=Danio rerio OX=7955 GN=rarga PE=1 SV=2
4	AFDB:E7BBH7	0.580	0.526	4.941E-51	502	0.767	0.693	E7BBH7.pdb.gz	E7BBH7_ONCMY Retinoic acid receptor, gamma, variant a OS=Oncorhynchus mykiss OX=8022 GN=rarg a PE=2 SV=1
5	AFDB:P22448	0.744	0.742	1.009E-50	455	0.722	0.721	P22448.pdb.gz	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
6	AFDB:A0A0G2JW78	0.769	0.756	2.578E-50	462	0.711	0.699	A0A0G2JW78.pdb.gz	A0A0G2JW78_RAT Retinoic acid receptor, alpha OS=Rattus norvegicus OX=10116 GN=Rara PE=3 SV=1
7	AFDB:P22605	0.550	0.519	3.223E-50	482	0.731	0.689	P22605.pdb.gz	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
8	AFDB:Q7ZTI3	0.773	0.767	4.818E-50	458	0.694	0.688	Q7ZTI3.pdb.gz	RARAB_DANRE Retinoic acid receptor alpha-B OS=Danio rerio OX=7955 GN=rarab PE=2 SV=1
9	AFDB:A2T928	0.561	0.522	9.413E-50	489	0.751	0.697	A2T928.pdb.gz	RARGB_DANRE Retinoic acid receptor gamma-B OS=Danio rerio OX=7955 GN=rargb PE=2 SV=1
10	AFDB:F1D8N9	0.570	0.566	1.346E-49	457	0.692	0.687	F1D8N9.pdb.gz	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
11	PDB:6fx0A	0.520	0.988	2.901E-32	238	0.524	1.000	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
12	PDB:3dzyA	0.533	0.763	3.981E-18	302	0.233	0.351	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
13	PDB:1g2nA	0.392	0.701	1.930E-7	246	0.128	0.236	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.368	0.613	4.099E-5	259	0.084	0.147	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:4q25A	0.122	0.213	7.240E-1	211	0.084	0.180	4q25A.pdb.gz
16	PDB:1ggqA	0.084	0.175	7.916E-1	162	0.055	0.154	1ggqA.pdb.gz
17	PDB:7w0bA	0.110	0.040	7.916E-1	1586	0.051	0.015	7w0bA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
18	PDB:5ogeG	0.109	0.139	1.237	306	0.059	0.088	5ogeG.pdb.gz
19	PDB:1szqA	0.094	0.091	1.617	473	0.064	0.061	1szqA.pdb.gz
20	PDB:7egmE	0.069	0.072	1.617	422	0.101	0.109	7egmE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW78	620	462	0.714	0.701	A0A0G2JW78_RAT Retinoic acid receptor, alpha OS=Rattus norvegicus OX=10116 GN=Rara PE=3 SV=1
2	A0A8I6A7Z0	649	455	0.716	0.714	A0A8I6A7Z0_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
3	A0A8I6AIB6	646	408	0.687	0.765	A0A8I6AIB6_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
4	A2T928	667	489	0.756	0.701	RARGB_DANRE Retinoic acid receptor gamma-B OS=Danio rerio OX=7955 GN=rargb PE=2 SV=1
5	A8K3H3	935	454	1.000	1.000	A8K3H3_HUMAN Retinoic acid nuclear receptor gamma variant 1 OS=Homo sapiens OX=9606 GN=RARG PE=2 SV=1
6	A8MUP8	613	478	0.687	0.653	A8MUP8_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1
7	D3ZF61	906	458	0.969	0.961	D3ZF61_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
8	D3ZFD9	651	448	0.694	0.703	D3ZFD9_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=2
9	D3ZWV0	719	485	0.848	0.794	D3ZWV0_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
10	E7BBH7	676	502	0.751	0.679	E7BBH7_ONCMY Retinoic acid receptor, gamma, variant a OS=Oncorhynchus mykiss OX=8022 GN=rarg a PE=2 SV=1
11	F1D8N9	610	457	0.665	0.661	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
12	F1D8S6	657	448	0.698	0.708	F1D8S6_HUMAN Retinoic acid receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1B2 PE=2 SV=1
13	P10276	616	462	0.705	0.693	RARA_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2
14	P10826	649	455	0.714	0.712	RARB_HUMAN Retinoic acid receptor beta OS=Homo sapiens OX=9606 GN=RARB PE=1 SV=2
15	P11416	619	462	0.711	0.699	RARA_MOUSE Retinoic acid receptor alpha OS=Mus musculus OX=10090 GN=Rara PE=1 SV=1
16	P13631	935	454	1.000	1.000	RARG_HUMAN Retinoic acid receptor gamma OS=Homo sapiens OX=9606 GN=RARG PE=1 SV=1
17	P18911	914	458	0.978	0.969	RARG_MOUSE Retinoic acid receptor gamma OS=Mus musculus OX=10090 GN=Rarg PE=1 SV=3
18	P22448	650	455	0.722	0.721	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
19	P22605	649	482	0.729	0.687	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
20	P51126	596	458	0.676	0.670	RARA_XENLA Retinoic acid receptor alpha OS=Xenopus laevis OX=8355 GN=rara PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	5.5e-17	73.6	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	2.9e-29	112.6	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000002393

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000017419	0.916	Retinoid X receptor, alpha
2	9555.ENSPANP00000012407	0.898	Retinoid X receptor, beta
3	9555.ENSPANP00000001509	0.896	Nuclear receptor coactivator 1
4	9555.ENSPANP00000019731	0.895	Nuclear receptor corepressor 1
5	9555.ENSPANP00000011773	0.893	Nuclear receptor corepressor 2
6	9555.ENSPANP00000011383	0.890	Nuclear receptor coactivator 2
7	9555.ENSPANP00000014254	0.880	Promyelocytic leukemia
8	9555.ENSPANP00000004047	0.870	Retinoid X receptor, gamma
9	9555.ENSPANP00000000045	0.863	Nuclear receptor interacting protein 1
10	9555.ENSPANP00000015956	0.862	Nuclear receptor coactivator 3
11	9555.ENSPANP00000020591	0.850	Retinoic acid receptor, alpha
12	9555.ENSPANP00000020534	0.832	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
13	9555.ENSPANP00000013793	0.785	CREB binding protein
14	9555.ENSPANP00000017963	0.776	Belongs to the acetyltransferase family. GCN5 subfamily.
15	9555.ENSPANP00000007105	0.765	Cellular retinoic acid binding protein 2
16	9555.ENSPANP00000010328	0.765	Zinc finger and BTB domain containing 16
17	9555.ENSPANP00000013403	0.759	E1A binding protein p300
18	9555.ENSPANP00000001025	0.756	Cyclin H
19	9555.ENSPANP00000001366	0.745	Phosphoinositide-3-kinase regulatory subunit 1 alpha
20	9555.ENSPANP00000013336	0.744	V-akt murine thymoma viral oncogene homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003677	0.998	DNA binding
GO:0004879	0.996	nuclear receptor activity
GO:0043565	0.988	sequence-specific DNA binding
GO:0003690	0.953	double-stranded DNA binding
GO:1990837	0.912	sequence-specific double-stranded DNA binding
GO:0008134	0.842	transcription factor binding
GO:0001067	0.837	transcription regulatory region nucleic acid binding
GO:0000976	0.816	transcription cis-regulatory region binding
GO:0000977	0.495	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.334	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0030522	0.975	intracellular receptor signaling pathway
GO:0042221	0.854	response to chemical
GO:0048518	0.829	positive regulation of biological process
GO:0010033	0.814	response to organic substance
GO:0050793	0.806	regulation of developmental process
GO:0032502	0.796	developmental process
GO:0010468	0.752	regulation of gene expression
GO:0048522	0.745	positive regulation of cellular process
GO:2000026	0.715	regulation of multicellular organismal development
GO:0080090	0.703	regulation of primary metabolic process
GO:0031323	0.703	regulation of cellular metabolic process
GO:0009889	0.687	regulation of biosynthetic process
GO:0033993	0.681	response to lipid
GO:1901700	0.641	response to oxygen-containing compound
GO:0010556	0.628	regulation of macromolecule biosynthetic process
GO:0051171	0.626	regulation of nitrogen compound metabolic process
GO:0031326	0.626	regulation of cellular biosynthetic process
GO:0071310	0.625	cellular response to organic substance
GO:0032501	0.578	multicellular organismal process
GO:0048856	0.547	anatomical structure development
GO:0032526	0.494	response to retinoic acid
GO:0008152	0.471	metabolic process
GO:0071704	0.464	organic substance metabolic process
GO:0042127	0.444	regulation of cell population proliferation
GO:0006355	0.426	regulation of DNA-templated transcription
GO:0044238	0.425	primary metabolic process
GO:0031641	0.397	regulation of myelination
GO:0008284	0.396	positive regulation of cell population proliferation
GO:0044237	0.393	cellular metabolic process
GO:0007275	0.389	multicellular organism development
GO:0051094	0.388	positive regulation of developmental process
GO:0051240	0.306	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.911	protein-containing complex
GO:0043232	0.836	intracellular non-membrane-bounded organelle
GO:0005737	0.680	cytoplasm
GO:0005667	0.345	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]