StarFunc result for job id P13637

User Input

>input (1013 residues)
MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
ILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNL
YLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDL
VEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
EGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILS
LILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGST
STICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNR
AVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQL
SIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGE
RVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAG
IKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDL
KDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADI
GVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPF
LLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLI
SMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQ
RKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSY
CPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3b8eA	0.946	0.960	0.000	998	0.862	0.875	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
2	PDB:7x20A	0.942	0.967	0.000	986	0.643	0.660	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
3	PDB:8d3xA	0.954	0.977	0.000	989	0.974	0.998	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
4	AFDB:A2VDL6	0.983	0.977	0.000	1020	0.875	0.869	A2VDL6.pdb.gz	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
5	AFDB:A8QI34	0.975	0.979	0.000	1009	0.621	0.623	A8QI34.pdb.gz	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
6	AFDB:B0S5Q5	0.988	0.984	0.000	1017	0.840	0.837	B0S5Q5.pdb.gz
7	AFDB:B8JKS9	0.991	0.981	0.000	1023	0.765	0.758	B8JKS9.pdb.gz
8	AFDB:C0H8U1	0.988	0.974	0.000	1028	0.828	0.816	C0H8U1.pdb.gz	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
9	AFDB:E1B8N5	0.985	0.969	0.000	1030	0.793	0.780	E1B8N5.pdb.gz	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
10	AFDB:P13607	0.984	0.957	0.000	1041	0.764	0.744	P13607.pdb.gz	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
11	AFDB:P20648	0.985	0.964	0.000	1035	0.646	0.632	P20648.pdb.gz	ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=1 SV=5
12	AFDB:P54707	0.978	0.954	0.000	1039	0.645	0.628	P54707.pdb.gz	AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3
13	AFDB:P54708	0.987	0.966	0.000	1036	0.650	0.635	P54708.pdb.gz	AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus OX=10116 GN=Atp12a PE=1 SV=1
14	PDB:3ixzA	0.932	0.945	1.563E-97	998	0.639	0.648	3ixzA.pdb.gz
15	PDB:7e7sA	0.594	0.591	6.841E-56	1020	0.269	0.268	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
16	PDB:5zmwA	0.582	0.589	2.293E-53	1000	0.274	0.278	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:6a69A	0.555	0.606	8.025E-39	911	0.231	0.257	6a69A.pdb.gz
18	PDB:7vpkA	0.705	0.679	2.153E-35	1055	0.184	0.176	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.493	0.601	3.122E-34	804	0.197	0.249	7vh5A.pdb.gz
20	PDB:7kycA	0.617	0.541	7.219E-33	1178	0.189	0.162	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060D574	1572	875	0.744	0.862	A0A060D574_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1c PE=2 SV=1
2	A0A060D9G1	1485	876	0.691	0.799	A0A060D9G1_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1a PE=2 SV=1
3	A0A060XA63	967	517	0.446	0.874	A0A060XA63_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000245001 PE=3 SV=1
4	A0A060YJC3	1778	992	0.831	0.849	A0A060YJC3_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025817001 PE=3 SV=1
5	A0A060YK73	976	534	0.451	0.856	A0A060YK73_ONCMY Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025818001 PE=3 SV=1
6	A0A075Q735	1026	639	0.497	0.787	A0A075Q735_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
7	A0A075QE41	1068	661	0.516	0.791	A0A075QE41_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
8	A2VDL6	1851	1020	0.871	0.865	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
9	A8QI34	1300	1009	0.622	0.624	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
10	C0H8U1	1735	1028	0.822	0.810	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
11	C0PUF8	992	524	0.458	0.885	C0PUF8_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
12	E1B8N5	1652	1030	0.783	0.770	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
13	F1MR06	1947	988	0.940	0.964	F1MR06_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A3 PE=3 SV=3
14	P05023	1841	1023	0.864	0.855	AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1
15	P05024	1840	1021	0.865	0.858	AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa OX=9823 GN=ATP1A1 PE=1 SV=1
16	P06685	1819	1023	0.856	0.848	AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1
17	P06686	1843	1020	0.870	0.864	AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1
18	P06687	2091	1013	0.996	0.996	AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2
19	P09572	1798	1021	0.860	0.853	AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus OX=9031 GN=ATP1A1 PE=2 SV=1
20	P09626	1374	1033	0.641	0.628	ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus OX=10116 GN=Atp4a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	2.1e-20	83.9	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	6.9e-41	151.5	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	7.4e-14	62.5	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	2.1e-41	152.9	E1-E2 ATPase
5	PF00702 Hydrolase	1.4e-15	69.7	haloacid dehalogenase-like hydrolase
6	PF08282 Hydrolase_3	0.025	25.9	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010357296.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010370068.1	0.994	This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane.
2	61622.XP_010376574.1	0.993	Sodium/potassium-transporting ATPase subunit beta-3 isoform X1
3	61622.XP_010360688.1	0.982	This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane.
4	61622.XP_010361818.1	0.981	Retinoschisin
5	61622.XP_010362569.1	0.968	This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane.
6	61622.XP_010359071.1	0.947	Sodium/potassium-transporting ATPase subunit alpha-2
7	61622.XP_010359069.1	0.945	Sodium/potassium-transporting ATPase subunit alpha-4
8	61622.XP_010366208.1	0.945	ATPase Na+/K+ transporting subunit alpha 1
9	61622.XP_010374459.1	0.866	FXYD domain-containing ion transport regulator 4
10	61622.XP_010366674.1	0.865	ATP-binding cassette sub-family B member 9 isoform X1
11	61622.XP_010365721.1	0.800	FXYD domain containing ion transport regulator 2
12	61622.XP_010377551.1	0.799	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
13	61622.XP_010378691.1	0.794	Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
14	61622.XP_010373132.1	0.786	This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane.
15	61622.XP_010380879.1	0.750	ATP-binding cassette sub-family G member 8 isoform X1
16	61622.XP_010380881.1	0.750	ATP binding cassette subfamily G member 5
17	61622.XP_010360681.1	0.697	Sex hormone-binding globulin isoform X1
18	61622.XP_010351546.1	0.680	Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN.
19	61622.XP_010357110.1	0.653	Transmembrane protein 145
20	61622.XP_010380825.1	0.648	cAMP-dependent protein kinase catalytic subunit beta isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005391	0.998	P-type sodium:potassium-exchanging transporter activity
GO:0005488	0.996	binding
GO:0005515	0.994	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.965	multicellular organismal process
GO:0050789	0.958	regulation of biological process
GO:0050896	0.942	response to stimulus
GO:0051179	0.938	localization
GO:0009987	0.937	cellular process
GO:0006810	0.907	transport
GO:0021591	0.849	ventricular system development
GO:0098659	0.837	inorganic cation import across plasma membrane
GO:0034220	0.811	monoatomic ion transmembrane transport
GO:0030001	0.797	metal ion transport
GO:0042221	0.786	response to chemical
GO:0010033	0.754	response to organic substance
GO:0009719	0.753	response to endogenous stimulus
GO:0042391	0.752	regulation of membrane potential
GO:0098655	0.740	monoatomic cation transmembrane transport
GO:0050794	0.738	regulation of cellular process
GO:1901698	0.733	response to nitrogen compound
GO:0071805	0.722	potassium ion transmembrane transport
GO:0048878	0.717	chemical homeostasis
GO:0003008	0.716	system process
GO:1901700	0.715	response to oxygen-containing compound
GO:0003013	0.704	circulatory system process
GO:0051239	0.694	regulation of multicellular organismal process
GO:0035725	0.685	sodium ion transmembrane transport
GO:0050801	0.636	monoatomic ion homeostasis
GO:0140115	0.616	export across plasma membrane
GO:0055078	0.607	sodium ion homeostasis
GO:0060416	0.597	response to growth hormone
GO:0007626	0.577	locomotory behavior
GO:0042538	0.527	hyperosmotic salinity response
GO:0007154	0.453	cell communication
GO:0023052	0.377	signaling
GO:0019725	0.347	cellular homeostasis
GO:0051716	0.315	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.961	membrane-bounded organelle
GO:0098796	0.947	membrane protein complex
GO:1902495	0.943	transmembrane transporter complex
GO:0098797	0.917	plasma membrane protein complex
GO:0005622	0.903	intracellular anatomical structure
GO:0031982	0.890	vesicle
GO:0005737	0.836	cytoplasm
GO:0043229	0.825	intracellular organelle
GO:0043231	0.797	intracellular membrane-bounded organelle
GO:0005890	0.793	sodium:potassium-exchanging ATPase complex
GO:0098590	0.706	plasma membrane region
GO:0001917	0.680	photoreceptor inner segment
GO:0042383	0.679	sarcolemma
GO:0012505	0.517	endomembrane system
GO:0005576	0.486	extracellular region
GO:0030054	0.387	cell junction
GO:0031090	0.338	organelle membrane
GO:0043005	0.333	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18353	0.998	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	0.998	Na(+)/K(+)-exchanging ATPase.

[back to server]