StarFunc result for job id P13639

User Input

>input (858 residues)
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
RKGLKEGIPALDNFLDKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6d9j9	0.675	0.676	0.000	856	0.998	1.000	6d9j9.pdb.gz	Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
2	AFDB:A0A286Y8X9	0.997	0.995	0.000	860	0.927	0.924	A0A286Y8X9.pdb.gz
3	AFDB:C0H9N2	0.992	0.992	0.000	858	0.902	0.902	C0H9N2.pdb.gz	C0H9N2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
4	AFDB:O14460	0.976	0.994	0.000	842	0.645	0.657	O14460.pdb.gz	EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eft201 PE=1 SV=2
5	AFDB:P15112	0.966	0.988	0.000	839	0.645	0.659	P15112.pdb.gz	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
6	AFDB:P29691	0.970	0.976	0.000	852	0.795	0.800	P29691.pdb.gz	EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4
7	AFDB:P32324	0.972	0.991	0.000	842	0.663	0.676	P32324.pdb.gz	EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFT1 PE=1 SV=1
8	AFDB:Q38BE4	0.966	0.979	0.000	846	0.620	0.629	Q38BE4.pdb.gz	Q38BE4_TRYB2 Elongation factor 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2650 PE=4 SV=1
9	AFDB:Q54JV1	0.963	0.969	0.000	853	0.613	0.617	Q54JV1.pdb.gz	Q54JV1_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=cinC PE=4 SV=1
10	AFDB:Q5A0M4	0.975	0.994	0.000	842	0.655	0.667	Q5A0M4.pdb.gz	EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EFT2 PE=1 SV=2
11	AFDB:Q9ASR1	0.968	0.985	0.000	843	0.618	0.629	Q9ASR1.pdb.gz	EF2_ARATH Elongation factor 2 OS=Arabidopsis thaliana OX=3702 GN=LOS1 PE=1 SV=1
12	PDB:5juoDC	0.662	0.674	6.073E-95	841	0.661	0.674	5juoDC.pdb.gz	Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
13	PDB:7dvqC	0.911	0.868	2.411E-88	902	0.390	0.371	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:3dnyT	0.528	0.684	1.046E-83	654	0.522	0.685	3dnyT.pdb.gz
15	PDB:3jb9B	0.894	0.851	4.467E-81	904	0.362	0.344	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:6j6gC	0.874	0.817	1.466E-65	920	0.275	0.257	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
17	PDB:5lj3C	0.852	0.829	1.533E-59	882	0.266	0.259	5lj3C.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
18	PDB:5anbK	0.775	0.610	1.178E-46	1120	0.380	0.291	5anbK.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
19	PDB:7pjvx	0.450	0.536	3.125E-39	703	0.219	0.267	7pjvx.pdb.gz	Structural mechanism of GTPase-powered ribosome-tRNA movement.
20	PDB:7cdwA	0.379	0.451	1.458E-38	683	0.203	0.255	7cdwA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Elongation Factor G1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A4V7	642	969	0.395	0.350	A0A8I6A4V7_RAT 116 kDa U5 small nuclear ribonucleoprotein component OS=Rattus norvegicus OX=10116 GN=Eftud2 PE=1 SV=1
2	A0A8I6AI35	651	937	0.399	0.365	A0A8I6AI35_RAT 116 kDa U5 small nuclear ribonucleoprotein component OS=Rattus norvegicus OX=10116 GN=Eftud2 PE=1 SV=1
3	A8WFS1	645	973	0.393	0.346	A8WFS1_DANRE 116 kDa U5 small nuclear ribonucleoprotein component OS=Danio rerio OX=7955 GN=wu:fi20f05 PE=1 SV=1
4	B5X1W2	1648	858	0.915	0.915	B5X1W2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
5	C0H9N2	1623	858	0.902	0.902	C0H9N2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
6	C0HAQ6	1629	858	0.902	0.902	C0HAQ6_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
7	C0HBD9	1647	858	0.913	0.913	C0HBD9_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
8	F1LM66	652	972	0.399	0.352	F1LM66_RAT 116 kDa U5 small nuclear ribonucleoprotein component OS=Rattus norvegicus OX=10116 GN=Eftud2 PE=1 SV=3
9	F4JB05	1058	820	0.600	0.628	F4JB05_ARATH Ribosomal protein S5/Elongation factor G/III/V family protein OS=Arabidopsis thaliana OX=3702 GN=MGH6.2 PE=4 SV=1
10	F4JWP9	639	973	0.400	0.353	GFL_ARATH 109 kDa U5 small nuclear ribonucleoprotein component GFL OS=Arabidopsis thaliana OX=3702 GN=GFL PE=2 SV=1
11	O08810	652	971	0.399	0.352	U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus OX=10090 GN=Eftud2 PE=1 SV=1
12	O14460	1167	842	0.646	0.658	EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eft201 PE=1 SV=2
13	O94316	560	984	0.366	0.319	SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf10 PE=1 SV=2
14	P05197	1766	858	0.992	0.992	EF2_RAT Elongation factor 2 OS=Rattus norvegicus OX=10116 GN=Eef2 PE=1 SV=4
15	P13639	1777	858	1.000	1.000	EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4
16	P15112	1138	839	0.647	0.662	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
17	P29691	1426	852	0.798	0.804	EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4
18	P32324	1186	842	0.662	0.675	EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFT1 PE=1 SV=1
19	P58252	1764	858	0.991	0.991	EF2_MOUSE Elongation factor 2 OS=Mus musculus OX=10090 GN=Eef2 PE=1 SV=2
20	Q15029	651	972	0.397	0.351	U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00679 EFG_C	2.2e-19	80.6	Elongation factor G C-terminus
2	PF14492 EFG_III	9.9e-10	49.7	Elongation Factor G, domain III
3	PF03764 EFG_IV	7.2e-28	108.2	Elongation factor G, domain IV
4	PF00009 GTP_EFTU	4.4e-62	220.6	Elongation factor Tu GTP binding domain
5	PF03144 GTP_EFTU_D2	1.2e-08	46.6	Elongation factor Tu domain 2
6	PF01926 MMR_HSR1	0.052	25.0	50S ribosome-binding GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307940

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222247	0.999	Belongs to the eukaryotic ribosomal protein eL20 family.
2	9606.ENSP00000225430	0.999	Ribosomal protein L19
3	9606.ENSP00000251453	0.999	Ribosomal protein S16
4	9606.ENSP00000262584	0.999	60S ribosomal protein L8
5	9606.ENSP00000278572	0.999	40S ribosomal protein S3
6	9606.ENSP00000302896	0.999	Ribosomal protein S9
7	9606.ENSP00000307889	0.999	Ribosomal protein L13
8	9606.ENSP00000309334	0.999	Ribosomal protein L15
9	9606.ENSP00000311430	0.999	L ribosomal proteins
10	9606.ENSP00000322419	0.999	60S acidic ribosomal protein P2
11	9606.ENSP00000339095	0.999	40S ribosomal protein S7
12	9606.ENSP00000339795	0.999	60S ribosomal protein L7
13	9606.ENSP00000341885	0.999	Ribosomal protein S2
14	9606.ENSP00000346001	0.999	60S ribosomal protein L3
15	9606.ENSP00000346015	0.999	Ribosomal protein L27a
16	9606.ENSP00000346027	0.999	60S ribosomal protein L21
17	9606.ENSP00000346050	0.999	40S ribosomal protein S3a
18	9606.ENSP00000354739	0.999	60S ribosomal protein L12
19	9606.ENSP00000359345	0.999	60S ribosomal protein L5
20	9606.ENSP00000361076	0.999	Ribosomal protein L7a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.996	RNA binding
GO:0003824	0.975	catalytic activity
GO:0017111	0.956	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.953	GTPase activity
GO:0045182	0.935	translation regulator activity
GO:0008135	0.934	translation factor activity, RNA binding
GO:0003746	0.908	translation elongation factor activity
GO:0044877	0.862	protein-containing complex binding
GO:0043021	0.444	ribonucleoprotein complex binding
GO:0043022	0.314	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.967	cellular process
GO:0050896	0.962	response to stimulus
GO:0071704	0.953	organic substance metabolic process
GO:0044238	0.950	primary metabolic process
GO:0044237	0.950	cellular metabolic process
GO:0050789	0.927	regulation of biological process
GO:0051716	0.919	cellular response to stimulus
GO:0050794	0.910	regulation of cellular process
GO:0006807	0.889	nitrogen compound metabolic process
GO:0042221	0.867	response to chemical
GO:0043170	0.846	macromolecule metabolic process
GO:0051171	0.835	regulation of nitrogen compound metabolic process
GO:0048518	0.822	positive regulation of biological process
GO:0006518	0.804	peptide metabolic process
GO:0034645	0.794	cellular macromolecule biosynthetic process
GO:0010556	0.785	regulation of macromolecule biosynthetic process
GO:0006412	0.780	translation
GO:0009893	0.766	positive regulation of metabolic process
GO:0032501	0.765	multicellular organismal process
GO:0032502	0.722	developmental process
GO:0010468	0.681	regulation of gene expression
GO:0031323	0.652	regulation of cellular metabolic process
GO:0080090	0.651	regulation of primary metabolic process
GO:0071346	0.651	cellular response to type II interferon
GO:0007275	0.561	multicellular organism development
GO:0034248	0.513	regulation of amide metabolic process
GO:0009410	0.491	response to xenobiotic stimulus
GO:0048522	0.489	positive regulation of cellular process
GO:0031326	0.445	regulation of cellular biosynthetic process
GO:0051246	0.395	regulation of protein metabolic process
GO:0010604	0.394	positive regulation of macromolecule metabolic process
GO:0009792	0.366	embryo development ending in birth or egg hatching
GO:0051173	0.326	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0016020	0.976	membrane
GO:0005829	0.967	cytosol
GO:0032991	0.949	protein-containing complex
GO:0031981	0.945	nuclear lumen
GO:0071944	0.861	cell periphery
GO:1990904	0.492	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.956	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.956	nucleoside-triphosphate phosphatase.
RHEA:19669	0.953	GTP + H2O = GDP + H(+) + phosphate

[back to server]