StarFunc result for job id P13645

User Input

>input (584 residues)
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGG
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13645	1.000	1.000	2.516E-63	584	1.000	1.000	P13645.pdb.gz	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
2	AFDB:P02535	0.370	0.379	1.109E-40	570	0.817	0.837	P02535.pdb.gz	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
3	AFDB:Q99456	0.413	0.477	1.837E-26	494	0.459	0.543	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
4	AFDB:Q2M2I5	0.491	0.540	4.060E-26	525	0.490	0.545	Q2M2I5.pdb.gz	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
5	AFDB:Q6IFV4	0.323	0.419	4.060E-26	438	0.459	0.612	Q6IFV4.pdb.gz	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
6	AFDB:P08779	0.319	0.384	5.041E-26	473	0.459	0.567	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
7	AFDB:Q64291	0.312	0.366	8.351E-26	487	0.450	0.540	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
8	AFDB:P19012	0.342	0.428	9.647E-26	456	0.454	0.581	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
9	AFDB:Q61414	0.344	0.425	9.647E-26	452	0.443	0.573	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
10	AFDB:Q6IFV1	0.313	0.371	1.114E-25	485	0.466	0.561	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
11	PDB:4v60A	0.108	0.085	1.814	812	0.057	0.041	4v60A.pdb.gz
12	PDB:7qooU	0.133	0.319	4.978	186	0.053	0.167	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
13	PDB:7utlV	0.068	0.223	8.864	170	0.051	0.176	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02535	0.0	604	570	0.486	0.498	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
2	P13645	0.0	1093	584	1.000	1.000	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
3	Q7Z3Y7	7.69e-163	474	464	0.421	0.530	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
4	Q8VCW2	1.51e-156	457	446	0.404	0.529	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
5	Q64291	7.86e-156	457	487	0.384	0.460	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
6	Q6IFU8	1.28e-155	454	433	0.406	0.547	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
7	Q7Z3Y8	4.99e-155	454	459	0.425	0.540	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
8	Q9QWL7	6.37e-155	453	433	0.404	0.545	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
9	Q99456	2.61e-154	454	494	0.382	0.451	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
10	P13646	1.24e-153	451	458	0.372	0.474	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
11	Q2M2I5	1.75e-153	452	525	0.425	0.472	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
12	Q9Z320	4.09e-153	449	448	0.378	0.493	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
13	A1A4E9	7.13e-153	449	458	0.370	0.472	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
14	Q7Z3Z0	1.08e-152	448	450	0.387	0.502	K1C25_HUMAN Keratin, type I cytoskeletal 25 OS=Homo sapiens OX=9606 GN=KRT25 PE=1 SV=1
15	Q04695	1.13e-152	447	432	0.380	0.514	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
16	K7ERE3	2.28e-152	446	415	0.370	0.520	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
17	P02533	2.75e-152	447	472	0.373	0.462	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
18	P08730	6.35e-151	443	437	0.401	0.535	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
19	Q6IFV1	4.82e-150	442	485	0.368	0.443	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
20	Q61781	5.66e-150	442	484	0.366	0.442	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	42	16.0	Apg6 coiled-coil region
2	PF14362 DUF4407	5.5e+02	11.2	Domain of unknown function (DUF4407)
3	PF15397 DUF4618	32	15.4	Domain of unknown function (DUF4618)
4	PF00038 Filament	1.3e-110	381.5	Intermediate filament protein
5	PF13851 GAS	1.4e+02	13.3	Growth-arrest specific micro-tubule binding
6	PF09744 Jnk-SapK_ap_N	5.9e+02	12.2	JNK_SAPK-associated protein-1
7	PF07926 TPR_MLP1_2	37	15.8	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269576

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252244	0.979	Keratin, type II cytoskeletal 1
2	9606.ENSP00000310861	0.888	Keratin, type II cytoskeletal 2 epidermal
3	9606.ENSP00000252242	0.869	Keratin, type II cytoskeletal 5
4	9606.ENSP00000342710	0.869	Keratin, type II cytoskeletal 1b
5	9606.ENSP00000357731	0.861	Loricrin
6	9606.ENSP00000357753	0.857	Involucrin
7	9606.ENSP00000308720	0.835	Trypsin-1
8	9606.ENSP00000357789	0.831	Filaggrin
9	9606.ENSP00000301653	0.780	Keratin, type I cytoskeletal 16
10	9606.ENSP00000206765	0.687	Protein-glutamine gamma-glutamyltransferase K
11	9606.ENSP00000339435	0.628	Serine racemase
12	9606.ENSP00000257192	0.617	Desmoglein-1
13	9606.ENSP00000451828	0.594	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000366047	0.559	Kallikrein-6
15	9606.ENSP00000251645	0.548	Keratin, type I cuticular Ha1
16	9606.ENSP00000007735	0.543	Keratin, type I cuticular Ha3-I
17	9606.ENSP00000251646	0.542	Keratin, type I cuticular Ha3-II
18	9606.ENSP00000329165	0.516	Keratin, type I cuticular Ha6
19	9606.ENSP00000377570	0.516	Keratin, type I cuticular Ha4
20	9606.ENSP00000246646	0.515	Keratin, type I cuticular Ha8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding
GO:0046983	0.852	protein dimerization activity
GO:0046982	0.843	protein heterodimerization activity
GO:0030280	0.446	structural constituent of skin epidermis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048856	0.995	anatomical structure development
GO:0043588	0.965	skin development
GO:0008544	0.964	epidermis development
GO:0009913	0.922	epidermal cell differentiation
GO:0071840	0.905	cellular component organization or biogenesis
GO:0016043	0.897	cellular component organization
GO:0071704	0.882	organic substance metabolic process
GO:0006807	0.867	nitrogen compound metabolic process
GO:0030216	0.857	keratinocyte differentiation
GO:0044238	0.856	primary metabolic process
GO:0018149	0.806	peptide cross-linking
GO:0050789	0.777	regulation of biological process
GO:0045103	0.777	intermediate filament-based process
GO:0097435	0.622	supramolecular fiber organization
GO:0022607	0.551	cellular component assembly
GO:0050896	0.544	response to stimulus
GO:0050794	0.472	regulation of cellular process
GO:0006996	0.457	organelle organization
GO:0051259	0.384	protein complex oligomerization
GO:0032501	0.355	multicellular organismal process
GO:0048518	0.353	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005576	0.999	extracellular region
GO:0016020	0.997	membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005856	0.997	cytoskeleton
GO:0031982	0.996	vesicle
GO:1903561	0.993	extracellular vesicle
GO:0001533	0.991	cornified envelope
GO:0099513	0.986	polymeric cytoskeletal fiber
GO:0005882	0.979	intermediate filament
GO:0005829	0.973	cytosol
GO:0045095	0.973	keratin filament
GO:0005634	0.959	nucleus
GO:0005615	0.938	extracellular space
GO:0070062	0.893	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]