StarFunc result for job id P13646

User Input

>input (458 residues)
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSG
FGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGGLLTGNEKITMQNLNDRLASYLE
KVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEI
DNARLAADDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMK
KNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHTKS
AELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQL
QQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFP
SSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1A4E9	0.419	0.419	1.502E-58	458	0.996	0.996	A1A4E9.pdb.gz	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
2	AFDB:Q6IFV4	0.500	0.520	2.898E-48	438	0.812	0.849	Q6IFV4.pdb.gz	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
3	AFDB:P19012	0.596	0.599	2.380E-40	456	0.727	0.730	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
4	AFDB:Q61414	0.552	0.559	1.196E-39	452	0.694	0.704	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
5	AFDB:P08779	0.670	0.650	8.284E-36	473	0.611	0.592	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
6	AFDB:Q6IFV1	0.422	0.403	7.736E-34	485	0.616	0.581	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
7	AFDB:P02533	0.518	0.504	1.052E-33	472	0.629	0.610	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
8	AFDB:Q6PVZ1	0.595	0.584	3.334E-33	467	0.594	0.582	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
9	AFDB:Q9Z2K1	0.552	0.541	1.057E-32	469	0.579	0.565	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
10	AFDB:Q6IFU8	0.528	0.555	1.342E-30	433	0.570	0.603	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
11	PDB:8at3A	0.154	0.218	8.657	286	0.096	0.154	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A4E9	0.0	924	458	0.996	0.996	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
2	K7ERE3	0.0	841	415	0.906	1.000	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
3	P08730	0.0	634	437	0.788	0.826	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
4	P13646	0.0	928	458	1.000	1.000	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
5	P19012	0.0	534	456	0.646	0.649	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
6	Q61414	0.0	537	452	0.644	0.653	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
7	Q6IFV3	0.0	544	447	0.607	0.622	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
8	Q6IFV4	0.0	656	438	0.799	0.836	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
9	Q6IFU8	1.28e-168	483	433	0.524	0.554	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
10	Q9QWL7	6.04e-168	481	433	0.522	0.552	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
11	P02533	1.19e-166	479	472	0.524	0.508	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
12	P08779	1.28e-166	479	473	0.511	0.495	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
13	Q04695	1.95e-165	474	432	0.507	0.537	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
14	P19001	8.76e-164	469	403	0.513	0.583	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
15	Q6PVZ1	1.66e-163	471	467	0.498	0.488	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
16	Q6IFV1	2.37e-162	469	485	0.489	0.462	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
17	Q61781	1.55e-159	462	484	0.483	0.457	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
18	Q63279	2.49e-158	456	403	0.513	0.583	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
19	Q9Z2K1	6.00e-154	447	469	0.474	0.463	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
20	P08727	6.41e-153	442	400	0.500	0.573	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	6.8e+02	11.8	Autophagy protein 16 (ATG16)
2	PF00038 Filament	2.5e-115	397.0	Intermediate filament protein
3	PF07926 TPR_MLP1_2	22	16.5	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246635

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448220	0.728	Keratin, type II cytoskeletal 4
2	9606.ENSP00000357753	0.690	Involucrin
3	9606.ENSP00000355923	0.684	Tyrosine-protein phosphatase non-receptor type 14
4	9606.ENSP00000254043	0.669	Keratin, type I cytoskeletal 15
5	9606.ENSP00000427772	0.644	Protein KIBRA
6	9606.ENSP00000329243	0.602	Keratin, type II cytoskeletal 7
7	9606.ENSP00000369317	0.600	Keratin, type II cytoskeletal 6A
8	9606.ENSP00000281317	0.597	Methylmalonic aciduria type A protein, mitochondrial
9	9606.ENSP00000478942	0.556	Uroplakin-1a
10	9606.ENSP00000007735	0.551	Keratin, type I cuticular Ha3-I
11	9606.ENSP00000264033	0.551	E3 ubiquitin-protein ligase CBL
12	9606.ENSP00000400908	0.544	Myosin-binding protein C, slow-type
13	9606.ENSP00000251645	0.533	Keratin, type I cuticular Ha1
14	9606.ENSP00000251646	0.533	Keratin, type I cuticular Ha3-II
15	9606.ENSP00000225550	0.518	Keratin, type I cuticular Ha7
16	9606.ENSP00000225899	0.518	Keratin, type I cuticular Ha2
17	9606.ENSP00000310573	0.517	Keratin, type I cytoskeletal 25
18	9606.ENSP00000329165	0.512	Keratin, type I cuticular Ha6
19	9606.ENSP00000366984	0.506	Keratin, type I cytoskeletal 40
20	9606.ENSP00000301656	0.504	Keratin, type I cytoskeletal 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.937	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0048856	0.994	anatomical structure development
GO:0009987	0.989	cellular process
GO:0008544	0.911	epidermis development
GO:0060429	0.726	epithelium development
GO:0048513	0.617	animal organ development
GO:0032501	0.540	multicellular organismal process
GO:0050896	0.533	response to stimulus
GO:0050789	0.501	regulation of biological process
GO:0071840	0.487	cellular component organization or biogenesis
GO:0050794	0.464	regulation of cellular process
GO:0048869	0.456	cellular developmental process
GO:0016043	0.451	cellular component organization
GO:0030154	0.364	cell differentiation
GO:0030855	0.302	epithelial cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005576	0.998	extracellular region
GO:0005737	0.997	cytoplasm
GO:0005856	0.996	cytoskeleton
GO:0005615	0.994	extracellular space
GO:0043230	0.994	extracellular organelle
GO:0005829	0.992	cytosol
GO:0045111	0.988	intermediate filament cytoskeleton
GO:0099513	0.978	polymeric cytoskeletal fiber
GO:0005882	0.966	intermediate filament
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:1903561	0.926	extracellular vesicle
GO:0005634	0.925	nucleus
GO:0070062	0.899	extracellular exosome
GO:0045095	0.772	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]