StarFunc result for job id P13647

User Input

>input (590 residues)
MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGY
GSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGG
AGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFA
SFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
DSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEI
NFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESW
YQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR
GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECR
LSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGV
GLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13647	1.000	1.000	1.794E-71	590	1.000	1.000	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
2	AFDB:Q922U2	0.423	0.429	8.154E-60	580	0.886	0.902	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
3	AFDB:P02538	0.552	0.575	2.064E-50	564	0.769	0.805	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
4	AFDB:O95678	0.489	0.519	3.992E-48	551	0.742	0.795	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
5	AFDB:Q8BGZ7	0.420	0.444	1.123E-46	551	0.720	0.771	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
6	AFDB:Q9Z331	0.465	0.484	5.739E-46	562	0.715	0.751	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
7	AFDB:Q6PVZ5	0.337	0.332	8.815E-42	599	0.712	0.701	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
8	AFDB:A0A1D5PXP0	0.357	0.399	2.311E-41	522	0.661	0.747	A0A1D5PXP0.pdb.gz
9	AFDB:P12035	0.269	0.256	7.512E-39	628	0.676	0.635	P12035.pdb.gz	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
10	AFDB:H2EQW7	0.221	0.258	6.948E-38	499	0.625	0.739	H2EQW7.pdb.gz	H2EQW7_CHICK Keratin 75 OS=Gallus gallus OX=9031 GN=KRT75 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	H2EQW7	607	499	0.571	0.675	H2EQW7_CHICK Keratin 75 OS=Gallus gallus OX=9031 GN=KRT75 PE=2 SV=1
2	O95678	775	551	0.731	0.782	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
3	P02538	711	564	0.653	0.683	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
4	P04104	532	637	0.415	0.385	K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4
5	P04259	722	564	0.698	0.730	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
6	P04264	565	644	0.446	0.408	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
7	P05787	527	483	0.446	0.545	K2C8_HUMAN Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7
8	P07744	608	525	0.551	0.619	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
9	P08729	524	469	0.471	0.593	K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5
10	P12035	560	628	0.459	0.432	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
11	P13647	1175	590	1.000	1.000	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
12	P19013	594	520	0.566	0.642	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
13	P48668	721	564	0.695	0.727	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
14	P50446	694	553	0.608	0.649	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
15	Q01546	551	638	0.456	0.422	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
16	Q0IIN1	535	578	0.475	0.484	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
17	Q10758	523	483	0.458	0.559	K2C8_RAT Keratin, type II cytoskeletal 8 OS=Rattus norvegicus OX=10116 GN=Krt8 PE=1 SV=3
18	Q14CN4	555	511	0.478	0.552	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
19	Q29426	569	629	0.475	0.445	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
20	Q3SY84	560	523	0.483	0.545	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	7.4e+02	11.6	Afadin- and alpha -actinin-Binding
2	PF11839 Alanine_zipper	3.9e+02	12.8	Alanine-zipper, major outer membrane lipoprotein
3	PF17675 APG6_N	29	16.6	Apg6 coiled-coil region
4	PF08614 ATG16	1.6	20.5	Autophagy protein 16 (ATG16)
5	PF04108 ATG17_like	56	14.6	Autophagy protein ATG17-like domain
6	PF04513 Baculo_PEP_C	4e+02	12.5	Baculovirus polyhedron envelope protein, PEP, C terminus
7	PF10473 CENP-F_leu_zip	0.97	20.9	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
8	PF05335 DUF745	27	15.9	Protein of unknown function (DUF745)
9	PF00038 Filament	2.6e-115	396.9	Intermediate filament protein
10	PF16208 Keratin_2_head	2.2e-39	146.6	Keratin type II head
11	PF11887 Mce4_CUP1	1.1e+02	13.8	Cholesterol uptake porter CUP1 of Mce4, putative
12	PF04102 SlyX	1.7e+02	14.2	SlyX
13	PF09728 Taxilin	49	14.6	Myosin-like coiled-coil protein
14	PF07926 TPR_MLP1_2	0.081	24.4	TPR/MLP1/MLP2-like protein
15	PF12718 Tropomyosin_1	31	16.1	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252242

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000167586	0.994	Keratin, type I cytoskeletal 14
2	9606.ENSP00000301653	0.896	Keratin, type I cytoskeletal 16
3	9606.ENSP00000310861	0.890	Keratin, type II cytoskeletal 2 epidermal
4	9606.ENSP00000413479	0.877	Keratin, type II cytoskeletal 3
5	9606.ENSP00000269576	0.869	Keratin, type I cytoskeletal 10
6	9606.ENSP00000252244	0.849	Keratin, type II cytoskeletal 1
7	9606.ENSP00000323856	0.836	Plectin
8	9606.ENSP00000275493	0.811	Epidermal growth factor receptor
9	9606.ENSP00000269571	0.809	Receptor tyrosine-protein kinase erbB-2
10	9606.ENSP00000325120	0.802	Progesterone receptor
11	9606.ENSP00000253719	0.801	Napsin-A
12	9606.ENSP00000373487	0.796	Keratin, type I cytoskeletal 18
13	9606.ENSP00000264731	0.789	Tumor protein 63
14	9606.ENSP00000308452	0.783	Keratin, type I cytoskeletal 17
15	9606.ENSP00000307508	0.769	Calretinin
16	9606.ENSP00000252252	0.765	Keratin, type II cytoskeletal 6B
17	9606.ENSP00000264012	0.755	Cadherin-3
18	9606.ENSP00000263946	0.749	Plakophilin-1
19	9606.ENSP00000343129	0.745	Tripartite motif-containing protein 29
20	9606.ENSP00000405330	0.739	Estrogen receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding
GO:0097110	0.863	scaffold protein binding
GO:0005200	0.748	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032502	0.987	developmental process
GO:0048856	0.984	anatomical structure development
GO:0065007	0.880	biological regulation
GO:0050789	0.822	regulation of biological process
GO:0050896	0.733	response to stimulus
GO:0009888	0.703	tissue development
GO:0050794	0.635	regulation of cellular process
GO:0071840	0.528	cellular component organization or biogenesis
GO:0008544	0.445	epidermis development
GO:0032501	0.389	multicellular organismal process
GO:0016043	0.345	cellular component organization
GO:0048513	0.338	animal organ development
GO:0048869	0.335	cellular developmental process
GO:0030154	0.333	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.999	membrane-bounded organelle
GO:0005856	0.998	cytoskeleton
GO:0005829	0.996	cytosol
GO:0070062	0.989	extracellular exosome
GO:0005882	0.986	intermediate filament
GO:0016020	0.972	membrane
GO:0005634	0.969	nucleus
GO:0045095	0.968	keratin filament
GO:0071944	0.949	cell periphery
GO:0005886	0.934	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]