StarFunc result for job id P13674

User Input

>input (534 residues)
MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADY
YHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
ANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
RRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13674	1.000	1.000	1.973E-91	534	1.000	1.000	P13674.pdb.gz	P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2
2	AFDB:Q60716	0.918	0.913	1.859E-68	537	0.616	0.613	Q60716.pdb.gz	P4HA2_MOUSE Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus OX=10090 GN=P4ha2 PE=1 SV=1
3	AFDB:Q9VA69	0.895	0.871	6.465E-57	550	0.481	0.467	Q9VA69.pdb.gz	Q9VA69_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaEFB PE=1 SV=2
4	AFDB:Q20065	0.865	0.858	4.398E-53	539	0.468	0.464	Q20065.pdb.gz	P4HA2_CAEEL Prolyl 4-hydroxylase subunit alpha-2 OS=Caenorhabditis elegans OX=6239 GN=phy-2 PE=1 SV=1
5	AFDB:Q68VC1	0.848	0.823	5.224E-50	551	0.408	0.396	Q68VC1.pdb.gz	Q68VC1_BRUMA procollagen-proline 4-dioxygenase OS=Brugia malayi OX=6279 GN=bma-dpy-18.1 PE=2 SV=1
6	AFDB:Q10576	0.812	0.778	3.145E-49	559	0.423	0.404	Q10576.pdb.gz	P4HA1_CAEEL Prolyl 4-hydroxylase subunit alpha-1 OS=Caenorhabditis elegans OX=6239 GN=dpy-18 PE=1 SV=2
7	AFDB:A0A1P6BZ71	0.724	0.715	2.530E-47	541	0.446	0.440	A0A1P6BZ71.pdb.gz	A0A1P6BZ71_BRUMA procollagen-proline 4-dioxygenase OS=Brugia malayi OX=6279 GN=bma-dpy-18.2 PE=2 SV=1
8	AFDB:Q6W3E9	0.802	0.788	2.885E-45	544	0.371	0.364	Q6W3E9.pdb.gz	P4HA3_RAT Prolyl 4-hydroxylase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=P4ha3 PE=2 SV=1
9	AFDB:Q7Z4N8	0.817	0.803	7.439E-45	544	0.365	0.358	Q7Z4N8.pdb.gz	P4HA3_HUMAN Prolyl 4-hydroxylase subunit alpha-3 OS=Homo sapiens OX=9606 GN=P4HA3 PE=1 SV=1
10	AFDB:Q8T5S7	0.823	0.814	9.853E-43	540	0.337	0.333	Q8T5S7.pdb.gz	Q8T5S7_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaSG1 PE=2 SV=1
11	PDB:4nhyA	0.259	0.296	1.438E-4	461	0.069	0.080	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
12	PDB:4qkbA	0.232	0.589	3.037E-4	190	0.045	0.126	4qkbA.pdb.gz	The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
13	PDB:3kt4A	0.247	0.235	3.897E-4	563	0.062	0.059	3kt4A.pdb.gz	Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
14	PDB:7vjvA	0.235	0.521	4.526E-4	221	0.062	0.149	7vjvA.pdb.gz	Structural insights into the interactions and epigenetic functions of human nucleic acid repair protein ALKBH6.
15	PDB:3mguA	0.243	0.243	5.256E-4	533	0.049	0.049	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
16	PDB:7cy6A	0.191	0.125	5.525E-4	872	0.058	0.036	7cy6A.pdb.gz	Molecular mechanism for vitamin C-derived C 5 -glyceryl-methylcytosine DNA modification catalyzed by algal TET homologue CMD1.
17	PDB:1gp6A	0.225	0.317	1.828E-3	349	0.054	0.083	1gp6A.pdb.gz	Structure and Mechanism of Anthocyanidin Synthase from Arabidopsis Thaliana.
18	PDB:6fxrA	0.239	0.188	2.346E-3	700	0.051	0.039	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
19	PDB:4xaeA	0.199	0.300	3.495E-3	329	0.052	0.085	4xaeA.pdb.gz
20	PDB:2fdjA	0.226	0.509	4.059E-3	207	0.054	0.140	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15460	0.0	716	535	0.625	0.624	P4HA2_HUMAN Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2 PE=1 SV=1
2	P13674	0.0	1112	534	1.000	1.000	P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2
3	P54001	0.0	1028	534	0.940	0.940	P4HA1_RAT Prolyl 4-hydroxylase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=P4ha1 PE=2 SV=2
4	Q5VSQ6	0.0	1092	534	0.981	0.981	Q5VSQ6_HUMAN procollagen-proline 4-dioxygenase (Fragment) OS=Homo sapiens OX=9606 GN=P4HA1 PE=2 SV=1
5	Q60715	0.0	1044	534	0.953	0.953	P4HA1_MOUSE Prolyl 4-hydroxylase subunit alpha-1 OS=Mus musculus OX=10090 GN=P4ha1 PE=1 SV=2
6	Q60716	0.0	712	537	0.624	0.620	P4HA2_MOUSE Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus OX=10090 GN=P4ha2 PE=1 SV=1
7	Q9VA69	0.0	521	550	0.481	0.467	Q9VA69_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaEFB PE=1 SV=2
8	Q20065	1.03e-166	485	539	0.472	0.468	P4HA2_CAEEL Prolyl 4-hydroxylase subunit alpha-2 OS=Caenorhabditis elegans OX=6239 GN=phy-2 PE=1 SV=1
9	A0A1P6BZ71	5.04e-153	450	541	0.451	0.445	A0A1P6BZ71_BRUMA procollagen-proline 4-dioxygenase OS=Brugia malayi OX=6279 GN=bma-dpy-18.2 PE=2 SV=1
10	Q10576	5.96e-147	435	559	0.423	0.404	P4HA1_CAEEL Prolyl 4-hydroxylase subunit alpha-1 OS=Caenorhabditis elegans OX=6239 GN=dpy-18 PE=1 SV=2
11	Q68VC1	3.95e-144	428	551	0.410	0.397	Q68VC1_BRUMA procollagen-proline 4-dioxygenase OS=Brugia malayi OX=6279 GN=bma-dpy-18.1 PE=2 SV=1
12	Q6W3E9	1.34e-106	331	544	0.375	0.368	P4HA3_RAT Prolyl 4-hydroxylase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=P4ha3 PE=2 SV=1
13	Q7Z4N8	1.34e-101	318	544	0.365	0.358	P4HA3_HUMAN Prolyl 4-hydroxylase subunit alpha-3 OS=Homo sapiens OX=9606 GN=P4HA3 PE=1 SV=1
14	Q9VA63	1.09e-94	300	540	0.346	0.343	Q9VA63_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaSG1 PE=2 SV=2
15	Q8T5S7	3.04e-93	296	540	0.352	0.348	Q8T5S7_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaSG1 PE=2 SV=1
16	E7ENX0	2.41e-81	254	204	0.223	0.583	E7ENX0_HUMAN Prolyl 4-hydroxylase subunit alpha 2 (Fragment) OS=Homo sapiens OX=9606 GN=P4HA2 PE=1 SV=1
17	E7EPI9	7.23e-81	254	236	0.223	0.504	E7EPI9_HUMAN Prolyl 4-hydroxylase subunit alpha 2 (Fragment) OS=Homo sapiens OX=9606 GN=P4HA2 PE=1 SV=1
18	Q9I7H5	4.15e-80	262	527	0.328	0.332	Q9I7H5_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaSG2 PE=2 SV=1
19	E7ERI1	1.17e-71	228	184	0.199	0.576	E7ERI1_HUMAN Prolyl 4-hydroxylase subunit alpha 2 (Fragment) OS=Homo sapiens OX=9606 GN=P4HA2 PE=1 SV=1
20	Q9VA61	1.69e-68	231	542	0.309	0.304	Q9VA61_DROME procollagen-proline 4-dioxygenase OS=Drosophila melanogaster OX=7227 GN=PH4alphaNE2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03171 2OG-FeII_Oxy	4.2e-05	35.3	2OG-Fe(II) oxygenase superfamily
2	PF13640 2OG-FeII_Oxy_3	2.1e-12	59.1	2OG-Fe(II) oxygenase superfamily
3	PF14853 Fis1_TPR_C	1e+02	14.5	Fis1 C-terminal tetratricopeptide repeat
4	PF08336 P4Ha_N	8e-39	144.1	Prolyl 4-Hydroxylase alpha-subunit, N-terminal region
5	PF00515 TPR_1	2e+02	13.2	Tetratricopeptide repeat
6	PF07719 TPR_2	0.22	22.8	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000004548

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000016636	0.951	Protein disulfide-isomerase
2	9598.ENSPTRP00000007845	0.928	Uncharacterized protein
3	9598.ENSPTRP00000058509	0.925	Uncharacterized protein
4	9598.ENSPTRP00000027071	0.911	Leprecan-like 1
5	9598.ENSPTRP00000044162	0.904	Pyrroline-5-carboxylate reductase 1
6	9598.ENSPTRP00000035326	0.903	Pyrroline-5-carboxylate reductase
7	9598.ENSPTRP00000018613	0.900	Proline dehydrogenase
8	9598.ENSPTRP00000027448	0.900	Pan troglodytes leucine aminopeptidase 3 (LAP3), mRNA
9	9598.ENSPTRP00000025405	0.898	Cartilage associated protein
10	9598.ENSPTRP00000012236	0.894	Peptidyl-prolyl cis-trans isomerase
11	9598.ENSPTRP00000038972	0.819	Prolyl 4-hydroxylase, alpha polypeptide II
12	9598.ENSPTRP00000043595	0.779	Uncharacterized protein
13	9598.ENSPTRP00000055755	0.768	Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein (By similarity).
14	9598.ENSPTRP00000051552	0.736	Pan troglodytes protein disulfide isomerase family A, member 3 (PDIA3), mRNA
15	9598.ENSPTRP00000015952	0.707	Collagen, type I, alpha 2
16	9598.ENSPTRP00000017161	0.707	Thioredoxin-related transmembrane protein 3
17	9598.ENSPTRP00000026673	0.699	Uncharacterized protein
18	9598.ENSPTRP00000033204	0.696	Uncharacterized protein
19	9598.ENSPTRP00000048958	0.696	Collagen, type V, alpha 2
20	9598.ENSPTRP00000036359	0.685	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004656	1.000	procollagen-proline 4-dioxygenase activity
GO:0005515	0.998	protein binding
GO:0042802	0.387	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0018126	0.997	protein hydroxylation
GO:0018208	0.997	peptidyl-proline modification
GO:0009987	0.874	cellular process
GO:0071840	0.849	cellular component organization or biogenesis
GO:0016043	0.824	cellular component organization
GO:0030198	0.355	extracellular matrix organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0005739	0.861	mitochondrion
GO:0031974	0.635	membrane-enclosed lumen
GO:0043233	0.629	organelle lumen
GO:0070013	0.623	intracellular organelle lumen
GO:0016020	0.498	membrane
GO:0005788	0.465	endoplasmic reticulum lumen
GO:0032991	0.312	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18945	1.000	2-oxoglutarate + L-prolyl-[collagen] + O2 = CO2 + succinate + trans-4-hydroxy-L-prolyl-[collagen]
EC:1.14.11.2	1.000	procollagen-proline 4-dioxygenase.

[back to server]