StarFunc result for job id P13688

User Input

>input (526 residues)
MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQ
QLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWI
NNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTP
TISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH
ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWF
FKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP
QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDH
SNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13688	1.000	1.000	3.076E-101	526	1.000	1.000	P13688.pdb.gz	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
2	AFDB:P31809	0.629	0.635	1.475E-69	521	0.572	0.578	P31809.pdb.gz	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
3	AFDB:P16573	0.631	0.639	4.260E-69	519	0.551	0.559	P16573.pdb.gz	CEAM1_RAT Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4
4	AFDB:Q925P2	0.682	0.689	3.194E-68	520	0.540	0.546	Q925P2.pdb.gz	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
5	AFDB:A0A024R0K5	0.580	0.441	1.937E-67	702	0.582	0.436	A0A024R0K5.pdb.gz	A0A024R0K5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
6	AFDB:A0A087WYX0	0.532	0.533	1.531E-66	524	0.567	0.569	A0A087WYX0.pdb.gz	A0A087WYX0_HUMAN CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
7	AFDB:P40199	0.531	0.788	4.215E-57	344	0.521	0.797	P40199.pdb.gz	CEAM6_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 6 OS=Homo sapiens OX=9606 GN=CEACAM6 PE=1 SV=4
8	AFDB:P31997	0.521	0.764	6.196E-53	349	0.479	0.722	P31997.pdb.gz	CEAM8_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 8 OS=Homo sapiens OX=9606 GN=CEACAM8 PE=1 SV=2
9	AFDB:Q16557	0.403	0.489	7.038E-47	428	0.338	0.416	Q16557.pdb.gz	PSG3_HUMAN Pregnancy-specific beta-1-glycoprotein 3 OS=Homo sapiens OX=9606 GN=PSG3 PE=2 SV=2
10	AFDB:Q15228	0.416	0.524	1.169E-45	411	0.325	0.416	Q15228.pdb.gz	Q15228_HUMAN Pregnancy-specific beta-1 glycoprotein (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
11	PDB:1e07A	0.312	0.266	1.468E-31	642	0.481	0.394	1e07A.pdb.gz
12	PDB:5oj2B	0.221	0.177	8.224E-16	692	0.120	0.091	5oj2B.pdb.gz
13	PDB:6dldD	0.237	0.408	2.869E-14	269	0.112	0.219	6dldD.pdb.gz
14	PDB:6dlfA	0.238	0.470	4.415E-12	236	0.108	0.242	6dlfA.pdb.gz
15	PDB:1hzhH	0.237	0.260	1.087E-11	457	0.110	0.127	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
16	PDB:2rcjC	0.188	0.189	1.948E-11	523	0.122	0.122	2rcjC.pdb.gz
17	PDB:7sqcO0	0.189	0.114	4.797E-11	1140	0.095	0.044	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:1igaA	0.172	0.188	5.059E-11	475	0.150	0.166	1igaA.pdb.gz
19	PDB:1zvoC	0.174	0.178	6.594E-11	512	0.139	0.143	1zvoC.pdb.gz
20	PDB:1igtB	0.195	0.218	8.152E-11	444	0.127	0.151	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R0K5	0.0	614	702	0.589	0.442	A0A024R0K5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
2	A0A087WYX0	0.0	600	524	0.568	0.571	A0A087WYX0_HUMAN CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
3	P06731	0.0	614	702	0.589	0.442	CEAM5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4
4	P13688	0.0	1082	526	1.000	1.000	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
5	P16573	0.0	543	519	0.551	0.559	CEAM1_RAT Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4
6	P31809	0.0	551	521	0.572	0.578	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
7	P31997	0.0	524	349	0.485	0.731	CEAM8_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 8 OS=Homo sapiens OX=9606 GN=CEACAM8 PE=1 SV=2
8	P40199	0.0	560	344	0.521	0.797	CEAM6_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 6 OS=Homo sapiens OX=9606 GN=CEACAM6 PE=1 SV=4
9	Q925P2	0.0	520	520	0.542	0.548	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
10	Q15238	1.23e-123	367	335	0.357	0.561	PSG5_HUMAN Pregnancy-specific beta-1-glycoprotein 5 OS=Homo sapiens OX=9606 GN=PSG5 PE=1 SV=3
11	Q14002	5.77e-114	340	265	0.314	0.623	CEAM7_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 7 OS=Homo sapiens OX=9606 GN=CEACAM7 PE=1 SV=2
12	Q9UQ72	2.51e-112	338	335	0.356	0.558	PSG11_HUMAN Pregnancy-specific beta-1-glycoprotein 11 OS=Homo sapiens OX=9606 GN=PSG11 PE=2 SV=3
13	Q00887	1.18e-92	291	426	0.350	0.432	PSG9_HUMAN Pregnancy-specific beta-1-glycoprotein 9 OS=Homo sapiens OX=9606 GN=PSG9 PE=1 SV=2
14	Q13046	6.70e-91	286	419	0.304	0.382	PSG7_HUMAN Pregnancy-specific beta-1-glycoprotein 7 OS=Homo sapiens OX=9606 GN=PSG7 PE=2 SV=3
15	P11464	3.93e-90	284	419	0.304	0.382	PSG1_HUMAN Pregnancy-specific beta-1-glycoprotein 1 OS=Homo sapiens OX=9606 GN=PSG1 PE=1 SV=1
16	Q00888	4.98e-88	279	419	0.298	0.375	PSG4_HUMAN Pregnancy-specific beta-1-glycoprotein 4 OS=Homo sapiens OX=9606 GN=PSG4 PE=2 SV=3
17	Q15228	7.40e-87	275	411	0.338	0.433	Q15228_HUMAN Pregnancy-specific beta-1 glycoprotein (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
18	Q00889	2.39e-86	275	435	0.346	0.418	PSG6_HUMAN Pregnancy-specific beta-1-glycoprotein 6 OS=Homo sapiens OX=9606 GN=PSG6 PE=2 SV=1
19	Q16557	1.22e-82	265	428	0.298	0.367	PSG3_HUMAN Pregnancy-specific beta-1-glycoprotein 3 OS=Homo sapiens OX=9606 GN=PSG3 PE=2 SV=2
20	P40198	5.03e-79	249	252	0.232	0.484	CEAM3_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CEACAM3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	14	16.8	Adenovirus E3 region protein CR1
2	PF05790 C2-set	1.6	20.3	Immunoglobulin C2-set domain
3	PF08205 C2-set_2	41	15.6	CD80-like C2-set immunoglobulin domain
4	PF10873 CYYR1	1.1	21.2	Cysteine and tyrosine-rich protein 1
5	PF15756 DUF4690	98	15.0	Small Novel Rich in Cartilage
6	PF09163 Form-deh_trans	6.3e+02	11.6	Formate dehydrogenase N, transmembrane
7	PF07679 I-set	3.3e-30	115.3	Immunoglobulin I-set domain
8	PF00047 ig	1.3e-31	119.9	Immunoglobulin domain
9	PF13895 Ig_2	1.7e-31	119.6	Immunoglobulin domain
10	PF13927 Ig_3	1.1e-36	136.6	Immunoglobulin domain
11	PF16680 Ig_4	1.1e-06	40.4	T-cell surface glycoprotein CD3 delta chain
12	PF16681 Ig_5	0.0067	28.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
13	PF18452 Ig_6	3.4e-05	35.1	Immunoglobulin domain
14	PF19081 Ig_7	3.6	19.3	Ig-like domain CHU_C associated
15	PF16706 Izumo-Ig	0.045	25.0	Izumo-like Immunoglobulin domain
16	PF06328 Lep_receptor_Ig	4.9e+02	12.1	Ig-like C2-type domain
17	PF11465 Receptor_2B4	0.0039	28.7	Natural killer cell receptor 2B4
18	PF07686 V-set	1.2e-28	110.8	Immunoglobulin V-set domain
19	PF08204 V-set_CD47	1.1e+02	14.2	CD47 immunoglobulin-like domain
20	PF17794 Vault_2	6.9e+02	12.1	Major Vault Protein repeat domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000161559

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312002	0.992	Hepatitis A virus cellular receptor 2
2	9606.ENSP00000340944	0.979	Tyrosine-protein phosphatase non-receptor type 11
3	9606.ENSP00000344456	0.971	Catenin beta-1
4	9606.ENSP00000346839	0.949	Fibronectin type III domain containing
5	9606.ENSP00000293379	0.943	Integrin alpha-5
6	9606.ENSP00000358866	0.939	Filamin-A
7	9606.ENSP00000452786	0.928	Integrin beta-3
8	9606.ENSP00000315477	0.921	CD209 antigen
9	9606.ENSP00000379350	0.912	Integrin beta-1
10	9606.ENSP00000401303	0.899	SHC-transforming protein 1
11	9606.ENSP00000362680	0.898	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000260010	0.820	Toll-like receptor 2
13	9606.ENSP00000254301	0.795	Galectin-3
14	9606.ENSP00000475924	0.782	DNA polymerase delta interacting protein 2
15	9606.ENSP00000011653	0.700	T-cell surface glycoprotein CD4
16	9606.ENSP00000378856	0.673	Galectin-9
17	9606.ENSP00000329797	0.668	Cell adhesion molecule 1
18	9606.ENSP00000415283	0.657	Intercellular adhesion molecule 2
19	9606.ENSP00000160262	0.655	Intercellular adhesion molecule 3
20	9606.ENSP00000358430	0.641	Beta-tectorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.998	enzyme binding
GO:0042802	0.996	identical protein binding
GO:0019900	0.985	kinase binding
GO:0019901	0.978	protein kinase binding
GO:0019902	0.953	phosphatase binding
GO:0031005	0.949	filamin binding
GO:1990782	0.949	protein tyrosine kinase binding
GO:0019903	0.936	protein phosphatase binding
GO:0003779	0.918	actin binding
GO:0005102	0.415	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0048519	0.990	negative regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0032502	0.986	developmental process
GO:0048523	0.977	negative regulation of cellular process
GO:0048856	0.975	anatomical structure development
GO:0051239	0.974	regulation of multicellular organismal process
GO:0019222	0.971	regulation of metabolic process
GO:0048583	0.944	regulation of response to stimulus
GO:0002682	0.928	regulation of immune system process
GO:0050865	0.921	regulation of cell activation
GO:0022407	0.918	regulation of cell-cell adhesion
GO:0002683	0.912	negative regulation of immune system process
GO:0051241	0.911	negative regulation of multicellular organismal process
GO:0002697	0.903	regulation of immune effector process
GO:0048522	0.899	positive regulation of cellular process
GO:0032501	0.897	multicellular organismal process
GO:0002703	0.894	regulation of leukocyte mediated immunity
GO:0002698	0.889	negative regulation of immune effector process
GO:0002694	0.883	regulation of leukocyte activation
GO:0060255	0.881	regulation of macromolecule metabolic process
GO:0050863	0.853	regulation of T cell activation
GO:1903037	0.849	regulation of leukocyte cell-cell adhesion
GO:0098609	0.840	cell-cell adhesion
GO:0051716	0.825	cellular response to stimulus
GO:0002704	0.793	negative regulation of leukocyte mediated immunity
GO:0050776	0.779	regulation of immune response
GO:0007162	0.759	negative regulation of cell adhesion
GO:0045088	0.757	regulation of innate immune response
GO:0023051	0.753	regulation of signaling
GO:0010646	0.752	regulation of cell communication
GO:0030334	0.748	regulation of cell migration
GO:0009966	0.744	regulation of signal transduction
GO:0098742	0.742	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0042127	0.741	regulation of cell population proliferation
GO:0010941	0.741	regulation of cell death
GO:0060627	0.737	regulation of vesicle-mediated transport
GO:0022408	0.736	negative regulation of cell-cell adhesion
GO:0050866	0.728	negative regulation of cell activation
GO:0006950	0.720	response to stress
GO:0007154	0.716	cell communication
GO:0007165	0.710	signal transduction
GO:0002695	0.649	negative regulation of leukocyte activation
GO:0048585	0.645	negative regulation of response to stimulus
GO:1903038	0.630	negative regulation of leukocyte cell-cell adhesion
GO:0032102	0.626	negative regulation of response to external stimulus
GO:0050868	0.605	negative regulation of T cell activation
GO:0031341	0.602	regulation of cell killing
GO:0050777	0.598	negative regulation of immune response
GO:0001910	0.567	regulation of leukocyte mediated cytotoxicity
GO:0080090	0.564	regulation of primary metabolic process
GO:0051171	0.562	regulation of nitrogen compound metabolic process
GO:0009893	0.557	positive regulation of metabolic process
GO:0002706	0.556	regulation of lymphocyte mediated immunity
GO:0010468	0.549	regulation of gene expression
GO:0042269	0.541	regulation of natural killer cell mediated cytotoxicity
GO:0043067	0.539	regulation of programmed cell death
GO:0008285	0.530	negative regulation of cell population proliferation
GO:0031323	0.519	regulation of cellular metabolic process
GO:0002819	0.519	regulation of adaptive immune response
GO:0009892	0.516	negative regulation of metabolic process
GO:1903530	0.500	regulation of secretion by cell
GO:0071704	0.497	organic substance metabolic process
GO:0031348	0.491	negative regulation of defense response
GO:0002822	0.484	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0060548	0.472	negative regulation of cell death
GO:0048584	0.466	positive regulation of response to stimulus
GO:0010605	0.466	negative regulation of macromolecule metabolic process
GO:0017157	0.465	regulation of exocytosis
GO:0010604	0.463	positive regulation of macromolecule metabolic process
GO:0002684	0.456	positive regulation of immune system process
GO:0009888	0.450	tissue development
GO:0009653	0.443	anatomical structure morphogenesis
GO:0050854	0.439	regulation of antigen receptor-mediated signaling pathway
GO:0042981	0.434	regulation of apoptotic process
GO:0045824	0.428	negative regulation of innate immune response
GO:0016477	0.417	cell migration
GO:0031342	0.416	negative regulation of cell killing
GO:0002376	0.410	immune system process
GO:0051240	0.402	positive regulation of multicellular organismal process
GO:0042221	0.384	response to chemical
GO:0001911	0.381	negative regulation of leukocyte mediated cytotoxicity
GO:0051051	0.379	negative regulation of transport
GO:1902531	0.375	regulation of intracellular signal transduction
GO:0002707	0.375	negative regulation of lymphocyte mediated immunity
GO:0007166	0.369	cell surface receptor signaling pathway
GO:0043170	0.362	macromolecule metabolic process
GO:0002709	0.362	regulation of T cell mediated immunity
GO:0006807	0.359	nitrogen compound metabolic process
GO:0002820	0.359	negative regulation of adaptive immune response
GO:0051246	0.353	regulation of protein metabolic process
GO:0060429	0.335	epithelium development
GO:0050793	0.324	regulation of developmental process
GO:0065009	0.318	regulation of molecular function
GO:0009967	0.314	positive regulation of signal transduction
GO:0043066	0.308	negative regulation of apoptotic process
GO:0030154	0.300	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005576	0.990	extracellular region
GO:0030141	0.986	secretory granule
GO:0030659	0.984	cytoplasmic vesicle membrane
GO:0098590	0.983	plasma membrane region
GO:0009986	0.980	cell surface
GO:0098588	0.977	bounding membrane of organelle
GO:0030667	0.968	secretory granule membrane
GO:0032991	0.961	protein-containing complex
GO:0005615	0.949	extracellular space
GO:0045177	0.915	apical part of cell
GO:1903561	0.787	extracellular vesicle
GO:0070062	0.784	extracellular exosome
GO:0016324	0.707	apical plasma membrane
GO:0070161	0.579	anchoring junction
GO:0070820	0.463	tertiary granule
GO:0035579	0.458	specific granule membrane
GO:0070821	0.450	tertiary granule membrane
GO:0070013	0.427	intracellular organelle lumen
GO:0005634	0.376	nucleus
GO:0005829	0.364	cytosol
GO:0005764	0.312	lysosome
GO:0098796	0.308	membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]