StarFunc result for job id P13693

User Input

>input (172 residues)
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGE
GTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAE
QIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J2C3	0.978	0.856	5.848E-32	197	1.000	0.873	A0A0B4J2C3.pdb.gz	A0A0B4J2C3_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
2	PDB:2hr9A	0.830	0.822	6.210E-28	174	1.000	0.989	2hr9A.pdb.gz
3	PDB:5o9lA	0.866	0.936	2.981E-27	159	0.878	0.950	5o9lA.pdb.gz
4	AFDB:Q7ZYF2	0.936	0.936	2.126E-25	172	0.686	0.686	Q7ZYF2.pdb.gz	TCTP_XENLA Translationally-controlled tumor protein homolog OS=Xenopus laevis OX=8355 GN=tpt1 PE=1 SV=1
5	AFDB:Q10344	0.846	0.866	2.878E-19	168	0.494	0.506	Q10344.pdb.gz	TCTP_SCHPO Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=p23fy PE=1 SV=1
6	AFDB:Q9VGS2	0.849	0.849	2.878E-19	172	0.483	0.483	Q9VGS2.pdb.gz	TCTP_DROME Translationally-controlled tumor protein homolog OS=Drosophila melanogaster OX=7227 GN=Tctp PE=1 SV=1
7	AFDB:Q54RX6	0.900	0.890	8.680E-19	174	0.407	0.402	Q54RX6.pdb.gz	TCTP1_DICDI Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282853 PE=3 SV=1
8	AFDB:P35691	0.840	0.864	2.331E-18	167	0.419	0.431	P35691.pdb.gz	TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMA19 PE=1 SV=1
9	PDB:1h6qA	0.810	0.829	6.464E-18	168	0.494	0.506	1h6qA.pdb.gz
10	AFDB:Q5A860	0.840	0.864	1.496E-17	167	0.424	0.437	Q5A860.pdb.gz	TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TMA19 PE=3 SV=1
11	AFDB:Q5BFN9	0.874	0.842	1.018E-16	179	0.390	0.374	Q5BFN9.pdb.gz	TCTP_EMENI Translationally-controlled tumor protein homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN0641 PE=1 SV=1
12	AFDB:P31265	0.844	0.863	3.253E-16	168	0.360	0.369	P31265.pdb.gz	TCTP1_ARATH Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana OX=3702 GN=TCTP1 PE=1 SV=2
13	AFDB:Q8I3Z5	0.798	0.803	2.959E-15	171	0.331	0.333	Q8I3Z5.pdb.gz	TCTP_PLAF7 Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TCTP PE=1 SV=1
14	PDB:3p3kA	0.767	0.828	1.334E-13	159	0.291	0.314	3p3kA.pdb.gz
15	PDB:2kwbA	0.637	0.604	1.026E-9	183	0.395	0.372	2kwbA.pdb.gz
16	PDB:5ahjL	0.171	0.142	2.225	222	0.105	0.081	5ahjL.pdb.gz	Macyranones: Structure, Biosynthesis, and Binding Mode of an Unprecedented Epoxyketone that Targets the 20S Proteasome.
17	PDB:5x7yB	0.108	0.114	2.225	161	0.058	0.062	5x7yB.pdb.gz
18	PDB:7ls6M	0.159	0.170	2.499	160	0.105	0.113	7ls6M.pdb.gz
19	PDB:5ltwL	0.118	0.184	2.975	100	0.064	0.110	5ltwL.pdb.gz
20	PDB:6f2rQ	0.096	0.157	2.975	89	0.070	0.135	6f2rQ.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5W0H4	3.48e-127	356	188	1.000	0.915	Q5W0H4_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
2	A0A0P1J1R0	6.91e-127	355	172	1.000	1.000	A0A0P1J1R0_HUMAN Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=seTCTP PE=3 SV=1
3	P13693	6.91e-127	355	172	1.000	1.000	TCTP_HUMAN Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
4	A0A0B4J2C3	2.17e-126	355	197	1.000	0.873	A0A0B4J2C3_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
5	P63028	5.07e-123	345	172	0.959	0.959	TCTP_MOUSE Translationally-controlled tumor protein OS=Mus musculus OX=10090 GN=Tpt1 PE=1 SV=1
6	P63029	5.07e-123	345	172	0.959	0.959	TCTP_RAT Translationally-controlled tumor protein OS=Rattus norvegicus OX=10116 GN=Tpt1 PE=1 SV=1
7	J3KPG2	1.71e-117	331	160	0.930	1.000	J3KPG2_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
8	E9PJF7	1.64e-111	315	162	0.890	0.944	E9PJF7_HUMAN Tumor protein, translationally-controlled 1 (Fragment) OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
9	Q7ZYF2	1.97e-84	248	172	0.686	0.686	TCTP_XENLA Translationally-controlled tumor protein homolog OS=Xenopus laevis OX=8355 GN=tpt1 PE=1 SV=1
10	Q10344	7.55e-47	152	168	0.506	0.518	TCTP_SCHPO Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=p23fy PE=1 SV=1
11	Q9VGS2	3.58e-45	148	172	0.506	0.506	TCTP_DROME Translationally-controlled tumor protein homolog OS=Drosophila melanogaster OX=7227 GN=Tctp PE=1 SV=1
12	P35691	4.07e-42	140	167	0.419	0.431	TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMA19 PE=1 SV=1
13	Q5A860	1.36e-41	139	167	0.430	0.443	TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TMA19 PE=3 SV=1
14	Q54RX6	7.21e-35	122	174	0.424	0.420	TCTP1_DICDI Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282853 PE=3 SV=1
15	P31265	7.59e-29	106	168	0.384	0.393	TCTP1_ARATH Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana OX=3702 GN=TCTP1 PE=1 SV=2
16	Q8I3Z5	2.33e-25	97.8	171	0.349	0.351	TCTP_PLAF7 Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TCTP PE=1 SV=1
17	Q93573	1.04e-24	96.3	181	0.395	0.376	TCTP_CAEEL Translationally-controlled tumor protein homolog OS=Caenorhabditis elegans OX=6239 GN=tct-1 PE=1 SV=1
18	Q5BFN9	7.51e-23	91.3	179	0.378	0.363	TCTP_EMENI Translationally-controlled tumor protein homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN0641 PE=1 SV=1
19	Q57TT8	5.36e-20	84.0	170	0.343	0.347	Q57TT8_TRYB2 Translationally controlled tumor protein (TCTP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.660 PE=3 SV=1
20	Q9M9V9	3.58e-17	76.3	156	0.308	0.340	TCTP2_ARATH Translationally controlled tumor protein 2 OS=Arabidopsis thaliana OX=3702 GN=TCTP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20318 DUF6613	47	15.7	Family of unknown function (DUF6613)
2	PF03945 Endotoxin_N	2.3e+02	12.9	delta endotoxin, N-terminal domain
3	PF00838 TCTP	2.2e-72	254.3	Translationally controlled tumour protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9713.XP_006751392.1

Rank	PPI partner	STRING score	Description
1	9713.XP_006738785.1	0.989	Elongation factor 2
2	9713.XP_006745368.1	0.984	Ribosomal protein P0 is the functional equivalent of E.coli protein L10
3	9713.XP_006750009.1	0.982	60S ribosomal protein L4 isoform X1
4	9713.XP_006741292.1	0.981	40S ribosomal protein S17
5	9713.XP_006741415.1	0.981	Belongs to the eukaryotic ribosomal protein P1/P2 family.
6	9713.XP_006743459.1	0.981	Belongs to the universal ribosomal protein uS9 family.
7	9713.XP_006751829.1	0.980	Belongs to the eukaryotic ribosomal protein eL13 family.
8	9713.XP_006744820.1	0.979	40S ribosomal protein S3
9	9713.XP_006729628.1	0.978	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 16 ESTs
10	9713.XP_006736071.1	0.978	Belongs to the universal ribosomal protein uS12 family.
11	9713.XP_006738817.1	0.978	60S ribosomal protein L14 isoform X1
12	9713.XP_006747835.1	0.978	Belongs to the universal ribosomal protein uS7 family.
13	9713.XP_006745091.1	0.977	40S ribosomal protein S10 isoform X1
14	9713.XP_006735805.1	0.974	Belongs to the eukaryotic ribosomal protein eL6 family.
15	9713.XP_006745106.1	0.972	Belongs to the eukaryotic ribosomal protein eL15 family.
16	9713.XP_006737644.1	0.971	Belongs to the universal ribosomal protein uL5 family.
17	9713.XP_006744827.1	0.971	60S ribosomal protein L8
18	9713.XP_006734367.1	0.970	Coiled-coil domain-containing protein 178
19	9713.XP_006738019.1	0.970	Elongation factor 1-beta-like
20	9713.XP_006742485.1	0.970	Belongs to the universal ribosomal protein uS4 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043167	0.969	ion binding
GO:1901363	0.954	heterocyclic compound binding
GO:0097159	0.954	organic cyclic compound binding
GO:0003676	0.593	nucleic acid binding
GO:0003723	0.584	RNA binding
GO:0005509	0.455	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.904	regulation of cellular process
GO:0048518	0.619	positive regulation of biological process
GO:0048519	0.592	negative regulation of biological process
GO:0009987	0.563	cellular process
GO:0032502	0.514	developmental process
GO:0032501	0.472	multicellular organismal process
GO:0048522	0.343	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0043227	0.834	membrane-bounded organelle
GO:0043231	0.789	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]