StarFunc result for job id P13716

User Input

>input (330 residues)
MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKR
LEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACD
VCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE
ALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEAMTAFRRAGADIIITYYTPQLLQWLKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13716	1.000	1.000	2.543E-67	330	1.000	1.000	P13716.pdb.gz	HEM2_HUMAN Delta-aminolevulinic acid dehydratase OS=Homo sapiens OX=9606 GN=ALAD PE=1 SV=1
2	AFDB:P06214	0.996	0.996	9.910E-60	330	0.879	0.879	P06214.pdb.gz	HEM2_RAT Delta-aminolevulinic acid dehydratase OS=Rattus norvegicus OX=10116 GN=Alad PE=1 SV=1
3	PDB:5hmsA	0.993	0.993	9.963E-60	330	1.000	1.000	5hmsA.pdb.gz	Structural studies of substrate and product complexes of 5-aminolaevulinic acid dehydratase from humans, Escherichia coli and the hyperthermophile Pyrobaculum calidifontis.
4	PDB:2z1bB	0.936	0.965	6.760E-51	320	0.861	0.887	2z1bB.pdb.gz
5	PDB:1e51B	0.888	0.979	8.409E-50	299	0.897	0.990	1e51B.pdb.gz	The Crystal Structure of Human Ala-Dehydratase
6	AFDB:Q9VTV9	0.967	0.976	3.774E-48	327	0.600	0.606	Q9VTV9.pdb.gz	Q9VTV9_DROME Delta-aminolevulinic acid dehydratase OS=Drosophila melanogaster OX=7227 GN=Pbgs PE=1 SV=1
7	AFDB:P78974	0.972	0.975	2.681E-47	329	0.548	0.550	P78974.pdb.gz	HEM2_SCHPO Delta-aminolevulinic acid dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem2 PE=2 SV=2
8	AFDB:O42768	0.977	0.949	1.082E-45	340	0.527	0.512	O42768.pdb.gz	HEM2_CANGA Delta-aminolevulinic acid dehydratase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HEM2 PE=1 SV=1
9	AFDB:P05373	0.975	0.941	1.280E-45	342	0.527	0.509	P05373.pdb.gz	HEM2_YEAST Delta-aminolevulinic acid dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM2 PE=1 SV=2
10	PDB:2z1bD	0.878	0.978	5.394E-41	296	0.788	0.878	2z1bD.pdb.gz
11	PDB:1h7rA	0.970	0.936	5.071E-40	342	0.527	0.509	1h7rA.pdb.gz	The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Substrate and Three Inhibitors
12	AFDB:P9WMP5	0.939	0.941	2.977E-36	329	0.409	0.410	P9WMP5.pdb.gz	HEM2_MYCTU Delta-aminolevulinic acid dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hemB PE=1 SV=1
13	AFDB:Q9SFH9	0.944	0.728	3.330E-36	430	0.391	0.300	Q9SFH9.pdb.gz	HEM21_ARATH Delta-aminolevulinic acid dehydratase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HEMB1 PE=2 SV=1
14	AFDB:P0ACB2	0.915	0.931	2.646E-35	324	0.412	0.420	P0ACB2.pdb.gz	HEM2_ECOLI Delta-aminolevulinic acid dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=hemB PE=1 SV=2
15	PDB:1b4eA	0.923	0.942	3.723E-35	323	0.409	0.418	1b4eA.pdb.gz	X-ray structure of 5-aminolevulinic acid dehydratase from Escherichia coli complexed with the inhibitor levulinic acid at 2.0 A resolution.
16	AFDB:Q59643	0.937	0.918	2.103E-34	337	0.415	0.407	Q59643.pdb.gz	HEM2_PSEAE Delta-aminolevulinic acid dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hemB PE=1 SV=1
17	PDB:2c18A	0.934	0.926	6.094E-33	333	0.415	0.411	2c18A.pdb.gz	Probing the Active Site of Pseudomonas Aeruginosa Porphobilinogen Synthase Using Newly Developed Inhibitors.
18	PDB:3ho8D	0.457	0.185	5.869E-7	934	0.142	0.050	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
19	PDB:4hnvB	0.455	0.170	1.360E-6	1033	0.148	0.047	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
20	PDB:2vp8B	0.432	0.572	3.728E-6	236	0.142	0.199	2vp8B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06214	0.0	612	330	0.879	0.879	HEM2_RAT Delta-aminolevulinic acid dehydratase OS=Rattus norvegicus OX=10116 GN=Alad PE=1 SV=1
2	P10518	0.0	619	330	0.891	0.891	HEM2_MOUSE Delta-aminolevulinic acid dehydratase OS=Mus musculus OX=10090 GN=Alad PE=1 SV=1
3	P13716	0.0	681	330	1.000	1.000	HEM2_HUMAN Delta-aminolevulinic acid dehydratase OS=Homo sapiens OX=9606 GN=ALAD PE=1 SV=1
4	Q58DK5	0.0	639	329	0.927	0.930	HEM2_BOVIN Delta-aminolevulinic acid dehydratase OS=Bos taurus OX=9913 GN=ALAD PE=2 SV=1
5	Q9VTV9	4.01e-141	404	327	0.597	0.602	Q9VTV9_DROME Delta-aminolevulinic acid dehydratase OS=Drosophila melanogaster OX=7227 GN=Pbgs PE=1 SV=1
6	O42768	9.06e-126	365	340	0.527	0.512	HEM2_CANGA Delta-aminolevulinic acid dehydratase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HEM2 PE=1 SV=1
7	P78974	2.78e-125	363	329	0.552	0.553	HEM2_SCHPO Delta-aminolevulinic acid dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem2 PE=2 SV=2
8	P05373	4.01e-122	356	342	0.530	0.512	HEM2_YEAST Delta-aminolevulinic acid dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM2 PE=1 SV=2
9	Q9SFH9	5.37e-75	239	430	0.382	0.293	HEM21_ARATH Delta-aminolevulinic acid dehydratase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HEMB1 PE=2 SV=1
10	P9WMP5	1.39e-73	232	329	0.406	0.407	HEM2_MYCTU Delta-aminolevulinic acid dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hemB PE=1 SV=1
11	P0ACB2	4.66e-73	230	324	0.403	0.410	HEM2_ECOLI Delta-aminolevulinic acid dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=hemB PE=1 SV=2
12	Q59643	1.49e-72	229	337	0.409	0.401	HEM2_PSEAE Delta-aminolevulinic acid dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hemB PE=1 SV=1
13	Q8IL68	3.36e-45	161	451	0.297	0.217	Q8IL68_PLAF7 Delta-aminolevulinic acid dehydratase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1440300 PE=3 SV=1
14	Q13410	0.52	34.7	526	0.064	0.040	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
15	P0AFB8	1.9	32.7	469	0.042	0.030	NTRC_ECOLI DNA-binding transcriptional regulator NtrC OS=Escherichia coli (strain K12) OX=83333 GN=glnG PE=1 SV=1
16	P03029	2.0	32.7	469	0.042	0.030	NTRC_KLEPN DNA-binding transcriptional regulator NtrC OS=Klebsiella pneumoniae OX=573 GN=ntrC PE=1 SV=1
17	Q00934	2.0	32.7	445	0.058	0.043	PILR_PSEAE Response regulator protein PilR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pilR PE=1 SV=2
18	Q54DF9	2.6	32.3	364	0.073	0.066	DCUP_DICDI Uroporphyrinogen decarboxylase OS=Dictyostelium discoideum OX=44689 GN=hemE PE=1 SV=1
19	Q72DI3	2.7	32.3	476	0.042	0.029	Q72DI3_DESVH Sigma-54 dependent transcriptional regulator/response regulator OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0946 PE=1 SV=1
20	Q8TF40	3.4	32.0	1166	0.070	0.020	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00490 ALAD	1.1e-124	427.3	Delta-aminolevulinic acid dehydratase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386284

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278715	0.997	Porphobilinogen deaminase
2	9606.ENSP00000332369	0.985	5-aminolevulinate synthase, erythroid-specific, mitochondrial
3	9606.ENSP00000378416	0.985	5-aminolevulinate synthase, nonspecific, mitochondrial
4	9606.ENSP00000246337	0.980	Uroporphyrinogen decarboxylase
5	9606.ENSP00000357787	0.978	Uroporphyrinogen-III synthase
6	9606.ENSP00000264193	0.957	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
7	9606.ENSP00000372326	0.947	Ferrochelatase, mitochondrial
8	9606.ENSP00000356978	0.942	Protoporphyrinogen oxidase
9	9606.ENSP00000273158	0.793	Solute carrier family 25 member 38
10	9606.ENSP00000262030	0.780	ATP synthase subunit beta, mitochondrial
11	9606.ENSP00000258955	0.739	Radical S-adenosyl methionine domain-containing protein 1, mitochondrial
12	9606.ENSP00000265316	0.695	ATP-binding cassette sub-family B member 6, mitochondrial
13	9606.ENSP00000309477	0.674	Cytoplasmic aconitate hydratase
14	9606.ENSP00000261486	0.672	Erythrocyte membrane protein band 4.1 like 4A
15	9606.ENSP00000362271	0.619	Adenylate kinase isoenzyme 1
16	9606.ENSP00000355637	0.611	ATP-binding cassette sub-family B member 10, mitochondrial
17	9606.ENSP00000261507	0.594	Methylsterol monooxygenase 1
18	9606.ENSP00000425809	0.594	Phosphoacetylglucosamine mutase
19	9606.ENSP00000328203	0.592	E3 ubiquitin-protein ligase TRAIP
20	9606.ENSP00000216117	0.590	Heme oxygenase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004655	1.000	porphobilinogen synthase activity
GO:0005488	0.998	binding
GO:0005515	0.954	protein binding
GO:0043167	0.792	ion binding
GO:0042802	0.541	identical protein binding
GO:0008270	0.417	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0046483	0.987	heterocycle metabolic process
GO:0006725	0.987	cellular aromatic compound metabolic process
GO:0046148	0.958	pigment biosynthetic process
GO:0006783	0.952	heme biosynthetic process
GO:0065007	0.685	biological regulation
GO:0050789	0.674	regulation of biological process
GO:0019222	0.473	regulation of metabolic process
GO:0050896	0.396	response to stimulus
GO:0051171	0.366	regulation of nitrogen compound metabolic process
GO:0060255	0.365	regulation of macromolecule metabolic process
GO:0080090	0.348	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005829	1.000	cytosol
GO:0070013	0.997	intracellular organelle lumen
GO:0005615	0.989	extracellular space
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0012505	0.971	endomembrane system
GO:0005634	0.916	nucleus
GO:1903561	0.884	extracellular vesicle
GO:0070062	0.806	extracellular exosome
GO:0031981	0.570	nuclear lumen
GO:0005654	0.460	nucleoplasm
GO:0031410	0.385	cytoplasmic vesicle
GO:0030141	0.307	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24064	1.000	2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen
EC:4.2.1.24	1.000	porphobilinogen synthase.

[back to server]