StarFunc result for job id P13725

User Input

>input (252 residues)
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMTRGQLPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13725	1.000	1.000	2.287E-33	252	1.000	1.000	P13725.pdb.gz	ONCM_HUMAN Oncostatin-M OS=Homo sapiens OX=9606 GN=OSM PE=1 SV=2
2	AFDB:P53347	0.611	0.586	7.086E-13	263	0.456	0.437	P53347.pdb.gz	ONCM_MOUSE Oncostatin-M OS=Mus musculus OX=10090 GN=Osm PE=1 SV=1
3	AFDB:F1QP70	0.508	0.548	2.002E-3	231	0.119	0.130	F1QP70.pdb.gz
4	AFDB:Q8K3I6	0.405	0.429	1.309E-2	234	0.143	0.154	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
5	AFDB:P15018	0.483	0.590	1.833E-2	202	0.183	0.228	P15018.pdb.gz	LIF_HUMAN Leukemia inhibitory factor OS=Homo sapiens OX=9606 GN=LIF PE=1 SV=1
6	AFDB:Q8NEV9	0.463	0.478	1.833E-2	243	0.147	0.152	Q8NEV9.pdb.gz	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
7	PDB:2q7nB	0.442	0.593	1.922E-2	180	0.131	0.183	2q7nB.pdb.gz
8	AFDB:P04095	0.475	0.524	2.568E-2	224	0.143	0.161	P04095.pdb.gz	PR2C2_MOUSE Prolactin-2C2 OS=Mus musculus OX=10090 GN=Prl2c2 PE=1 SV=1
9	AFDB:P18121	0.477	0.529	3.597E-2	224	0.107	0.121	P18121.pdb.gz	PR3D1_MOUSE Prolactin-3D1 OS=Mus musculus OX=10090 GN=Prl3d1 PE=2 SV=1
10	AFDB:Q9QUL0	0.517	0.600	4.802E-2	211	0.107	0.128	Q9QUL0.pdb.gz	PR3C1_RAT Prolactin-3C1 OS=Rattus norvegicus OX=10116 GN=Prl3c1 PE=2 SV=1
11	AFDB:P34207	0.472	0.525	5.287E-2	223	0.103	0.117	P34207.pdb.gz	PR3D4_RAT Prolactin-3D4 OS=Rattus norvegicus OX=10116 GN=Prl3d4 PE=1 SV=2
12	PDB:1a7mA	0.419	0.549	9.415E-2	180	0.139	0.194	1a7mA.pdb.gz
13	PDB:1rw5A	0.464	0.571	1.678E-1	199	0.091	0.116	1rw5A.pdb.gz
14	PDB:7u7nD	0.449	0.568	2.849E-1	191	0.119	0.157	7u7nD.pdb.gz
15	PDB:3qwrB	0.302	0.483	2.990E-1	141	0.095	0.170	3qwrB.pdb.gz
16	PDB:3duhC	0.309	0.529	3.292E-1	137	0.111	0.204	3duhC.pdb.gz
17	PDB:5ynxA	0.208	0.416	4.395E-1	117	0.087	0.188	5ynxA.pdb.gz
18	PDB:3d48P	0.407	0.583	4.612E-1	165	0.087	0.133	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
19	PDB:1huwA	0.352	0.486	5.867E-1	166	0.091	0.139	1huwA.pdb.gz
20	PDB:1cnt1	0.370	0.565	6.156E-1	150	0.115	0.193	1cnt1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13725	0.0	512	252	1.000	1.000	ONCM_HUMAN Oncostatin-M OS=Homo sapiens OX=9606 GN=OSM PE=1 SV=2
2	P53347	3.76e-49	164	263	0.377	0.361	ONCM_MOUSE Oncostatin-M OS=Mus musculus OX=10090 GN=Osm PE=1 SV=1
3	P03219	0.084	36.6	690	0.139	0.051	TRM3_EBVB9 Tripartite terminase subunit 3 OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=TRM3 PE=1 SV=2
4	O53541	0.24	35.0	451	0.135	0.075	O53541_MYCTX MCE family protein OS=Mycobacterium tuberculosis OX=1773 GN=mce4D PE=4 SV=1
5	Q9I433	3.2	31.2	275	0.075	0.069	PHNX_PSEAE Phosphonoacetaldehyde hydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phnX PE=1 SV=1
6	F4JAD4	4.4	30.8	331	0.091	0.069	F4JAD4_ARATH 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g47190 PE=1 SV=1
7	Q8JHW2	5.1	30.8	962	0.131	0.034	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
8	Q9VTH1	5.4	30.8	973	0.087	0.023	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01291 LIF_OSM	1.7e-73	257.6	LIF / OSM family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215781

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263409	0.999	Leukemia inhibitory factor receptor
2	9606.ENSP00000274276	0.997	Oncostatin-M-specific receptor subunit beta
3	9606.ENSP00000370698	0.990	Interleukin-6 receptor subunit beta
4	9606.ENSP00000385675	0.982	Interleukin-6
5	9606.ENSP00000264657	0.972	Signal transducer and activator of transcription 3
6	9606.ENSP00000222390	0.970	Hepatocyte growth factor
7	9606.ENSP00000344192	0.959	Interleukin-17A
8	9606.ENSP00000264498	0.956	Fibroblast growth factor 2
9	9606.ENSP00000361405	0.951	Matrix metalloproteinase-9
10	9606.ENSP00000412237	0.950	Interleukin-10
11	9606.ENSP00000478570	0.949	Vascular endothelial growth factor A
12	9606.ENSP00000218388	0.944	Metalloproteinase inhibitor 1
13	9606.ENSP00000299855	0.944	Stromelysin-1
14	9606.ENSP00000263341	0.940	Interleukin-1 beta
15	9606.ENSP00000322788	0.939	Interstitial collagenase
16	9606.ENSP00000221930	0.932	Transforming growth factor beta-1
17	9606.ENSP00000249075	0.931	Leukemia inhibitory factor
18	9606.ENSP00000219070	0.929	72 kDa type IV collagenase
19	9606.ENSP00000263339	0.927	Interleukin-1 alpha
20	9606.ENSP00000279804	0.927	Cardiotrophin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0005125	1.000	cytokine activity
GO:0005147	0.999	oncostatin-M receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0031347	0.976	regulation of defense response
GO:0051716	0.975	cellular response to stimulus
GO:0033135	0.975	regulation of peptidyl-serine phosphorylation
GO:0042221	0.973	response to chemical
GO:0042127	0.970	regulation of cell population proliferation
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0051240	0.968	positive regulation of multicellular organismal process
GO:0033138	0.965	positive regulation of peptidyl-serine phosphorylation
GO:1902531	0.964	regulation of intracellular signal transduction
GO:0071310	0.963	cellular response to organic substance
GO:0032101	0.962	regulation of response to external stimulus
GO:0008284	0.962	positive regulation of cell population proliferation
GO:0042531	0.960	positive regulation of tyrosine phosphorylation of STAT protein
GO:0010468	0.955	regulation of gene expression
GO:0050793	0.943	regulation of developmental process
GO:0009967	0.943	positive regulation of signal transduction
GO:0007166	0.936	cell surface receptor signaling pathway
GO:0034097	0.935	response to cytokine
GO:0045595	0.934	regulation of cell differentiation
GO:1902533	0.931	positive regulation of intracellular signal transduction
GO:0048519	0.924	negative regulation of biological process
GO:0048523	0.914	negative regulation of cellular process
GO:0010628	0.905	positive regulation of gene expression
GO:0071345	0.894	cellular response to cytokine stimulus
GO:0009889	0.874	regulation of biosynthetic process
GO:0019221	0.871	cytokine-mediated signaling pathway
GO:0001817	0.838	regulation of cytokine production
GO:0031326	0.831	regulation of cellular biosynthetic process
GO:0010556	0.820	regulation of macromolecule biosynthetic process
GO:0051094	0.770	positive regulation of developmental process
GO:2001141	0.770	regulation of RNA biosynthetic process
GO:0045893	0.757	positive regulation of DNA-templated transcription
GO:0032879	0.749	regulation of localization
GO:0001819	0.635	positive regulation of cytokine production
GO:0043408	0.590	regulation of MAPK cascade
GO:0043410	0.578	positive regulation of MAPK cascade
GO:0032103	0.576	positive regulation of response to external stimulus
GO:0050727	0.571	regulation of inflammatory response
GO:0051896	0.558	regulation of protein kinase B signaling
GO:0051049	0.549	regulation of transport
GO:0006357	0.538	regulation of transcription by RNA polymerase II
GO:0031349	0.537	positive regulation of defense response
GO:0051897	0.531	positive regulation of protein kinase B signaling
GO:0045944	0.522	positive regulation of transcription by RNA polymerase II
GO:0032502	0.516	developmental process
GO:0051046	0.513	regulation of secretion
GO:0010648	0.508	negative regulation of cell communication
GO:0023057	0.503	negative regulation of signaling
GO:1903530	0.493	regulation of secretion by cell
GO:0048856	0.487	anatomical structure development
GO:0032501	0.475	multicellular organismal process
GO:0065008	0.473	regulation of biological quality
GO:0014066	0.466	regulation of phosphatidylinositol 3-kinase signaling
GO:0050729	0.458	positive regulation of inflammatory response
GO:0009605	0.435	response to external stimulus
GO:0006950	0.429	response to stress
GO:0002682	0.421	regulation of immune system process
GO:0010817	0.417	regulation of hormone levels
GO:0002376	0.416	immune system process
GO:0046883	0.398	regulation of hormone secretion
GO:0046888	0.388	negative regulation of hormone secretion
GO:0008152	0.360	metabolic process
GO:0071704	0.338	organic substance metabolic process
GO:2000736	0.338	regulation of stem cell differentiation
GO:0032660	0.324	regulation of interleukin-17 production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.787	intracellular anatomical structure
GO:0005737	0.782	cytoplasm
GO:0005886	0.516	plasma membrane
GO:0043231	0.483	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]