StarFunc result for job id P13726

User Input

>input (295 residues)
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13726	1.000	1.000	3.090E-55	295	1.000	1.000	P13726.pdb.gz	TF_HUMAN Tissue factor OS=Homo sapiens OX=9606 GN=F3 PE=1 SV=1
2	AFDB:P42533	0.755	0.755	3.132E-35	295	0.539	0.539	P42533.pdb.gz	TF_RAT Tissue factor OS=Rattus norvegicus OX=10116 GN=F3 PE=2 SV=1
3	AFDB:P20352	0.738	0.740	1.050E-34	294	0.529	0.531	P20352.pdb.gz	TF_MOUSE Tissue factor OS=Mus musculus OX=10090 GN=F3 PE=1 SV=2
4	AFDB:B0UY88	0.637	0.652	1.479E-23	288	0.308	0.316	B0UY88.pdb.gz	B0UY88_DANRE Tissue factor OS=Danio rerio OX=7955 GN=zgc:112151 PE=3 SV=1
5	AFDB:Q8N6P7	0.566	0.308	3.698E-17	574	0.183	0.094	Q8N6P7.pdb.gz	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
6	AFDB:Q9UHF4	0.574	0.320	5.143E-17	553	0.210	0.112	Q9UHF4.pdb.gz	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
7	AFDB:Q08334	0.555	0.507	7.556E-17	325	0.207	0.188	Q08334.pdb.gz	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
8	AFDB:Q6PHB0	0.565	0.319	1.239E-16	546	0.200	0.108	Q6PHB0.pdb.gz	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
9	AFDB:P15261	0.555	0.369	1.309E-16	477	0.190	0.117	P15261.pdb.gz	INGR1_MOUSE Interferon gamma receptor 1 OS=Mus musculus OX=10090 GN=Ifngr1 PE=1 SV=3
10	AFDB:Q61190	0.558	0.477	1.461E-16	349	0.183	0.155	Q61190.pdb.gz	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
11	PDB:3besR	0.510	0.592	5.626E-10	250	0.115	0.136	3besR.pdb.gz
12	PDB:7z0lB	0.423	0.349	8.369E-8	370	0.081	0.065	7z0lB.pdb.gz
13	PDB:7u7nC	0.427	0.581	1.619E-7	200	0.095	0.140	7u7nC.pdb.gz
14	PDB:5mj3A	0.357	0.351	5.731E-7	302	0.095	0.093	5mj3A.pdb.gz
15	PDB:6pxvA	0.288	0.134	2.688E-5	823	0.081	0.029	6pxvA.pdb.gz
16	PDB:8eyyA	0.310	0.142	9.007E-5	775	0.088	0.034	8eyyA.pdb.gz
17	PDB:6h03A	0.249	0.082	9.516E-5	1223	0.092	0.022	6h03A.pdb.gz
18	PDB:8dtlA	0.292	0.147	2.170E-4	741	0.078	0.031	8dtlA.pdb.gz
19	PDB:7nycA	0.221	0.067	3.560E-4	1542	0.088	0.017	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:6kzbC	0.245	0.146	1.069E-3	649	0.085	0.039	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13726	0.0	606	295	1.000	1.000	TF_HUMAN Tissue factor OS=Homo sapiens OX=9606 GN=F3 PE=1 SV=1
2	P42533	1.26e-95	285	295	0.546	0.546	TF_RAT Tissue factor OS=Rattus norvegicus OX=10116 GN=F3 PE=2 SV=1
3	P20352	2.19e-94	282	294	0.536	0.537	TF_MOUSE Tissue factor OS=Mus musculus OX=10090 GN=F3 PE=1 SV=2
4	B0UY88	3.25e-37	135	288	0.319	0.326	B0UY88_DANRE Tissue factor OS=Danio rerio OX=7955 GN=zgc:112151 PE=3 SV=1
5	Q969J5	8.48e-06	48.5	263	0.210	0.236	I22R2_HUMAN Interleukin-22 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL22RA2 PE=1 SV=1
6	Q80XF5	1.39e-05	47.8	230	0.156	0.200	I22R2_MOUSE Interleukin-22 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il22ra2 PE=1 SV=2
7	Q9UHF4	2.45e-05	47.8	553	0.207	0.110	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
8	Q8N6P7	7.05e-05	46.6	574	0.159	0.082	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
9	P15261	1.85e-04	45.1	477	0.231	0.143	INGR1_MOUSE Interferon gamma receptor 1 OS=Mus musculus OX=10090 GN=Ifngr1 PE=1 SV=3
10	A0A142K3A7	1.93e-04	44.7	302	0.180	0.175	A0A142K3A7_MOUSE Interleukin-20 receptor subunit beta OS=Mus musculus OX=10090 GN=Il20rb PE=2 SV=1
11	E9Q9A6	3.48e-04	43.9	308	0.180	0.172	E9Q9A6_MOUSE Interleukin 20 receptor beta OS=Mus musculus OX=10090 GN=Il20rb PE=4 SV=1
12	Q6UXL0	0.001	42.4	311	0.200	0.190	I20RB_HUMAN Interleukin-20 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL20RB PE=1 SV=1
13	K7NA32	0.003	41.2	405	0.169	0.123	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
14	K7NAJ3	0.003	41.2	388	0.169	0.129	IRA1B_ONCMY Interferon alpha/beta receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=ifnar1b PE=2 SV=1
15	K9JA28	0.015	39.3	567	0.186	0.097	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
16	Q61190	0.023	38.5	349	0.169	0.143	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
17	Q80XZ4	0.036	38.1	581	0.142	0.072	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il22ra1 PE=1 SV=1
18	Q08334	0.13	35.8	325	0.180	0.163	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
19	Q3UVK9	0.35	34.7	332	0.176	0.157	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
20	Q6PHB0	0.35	35.0	546	0.203	0.110	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06143 Baculo_11_kDa	1.9e+02	13.0	Baculovirus 11 kDa family
2	PF12877 DUF3827	62	13.4	Domain of unknown function (DUF3827)
3	PF09294 Interfer-bind	1.7e-21	87.8	Interferon-alpha/beta receptor, fibronectin type III
4	PF01108 Tissue_fac	1.7e-24	97.1	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364731	0.999	Coagulation factor VII
2	9606.ENSP00000218099	0.998	Coagulation factor IX
3	9606.ENSP00000364709	0.996	Coagulation factor X
4	9606.ENSP00000308541	0.991	Prothrombin
5	9606.ENSP00000233156	0.988	Tissue factor pathway inhibitor
6	9606.ENSP00000356671	0.968	Antithrombin-III
7	9606.ENSP00000265171	0.966	Pro-epidermal growth factor
8	9606.ENSP00000356771	0.958	Coagulation factor V
9	9606.ENSP00000239938	0.950	Early growth response protein 1
10	9606.ENSP00000308938	0.905	Plasminogen
11	9606.ENSP00000263686	0.890	P-selectin
12	9606.ENSP00000261405	0.872	Von Willebrand factor
13	9606.ENSP00000384957	0.871	Coagulation factor XI
14	9606.ENSP00000353393	0.870	Coagulation factor VIII
15	9606.ENSP00000419038	0.869	Elongation factor G, mitochondrial
16	9606.ENSP00000366307	0.867	Thrombomodulin
17	9606.ENSP00000222543	0.866	Tissue factor pathway inhibitor 2
18	9606.ENSP00000223095	0.851	Plasminogen activator inhibitor 1
19	9606.ENSP00000255030	0.826	C-reactive protein
20	9606.ENSP00000216968	0.814	Endothelial protein C receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	0.999	protease binding
GO:0003824	0.971	catalytic activity
GO:0008233	0.961	peptidase activity
GO:0005543	0.865	phospholipid binding
GO:0017171	0.788	serine hydrolase activity
GO:0008236	0.771	serine-type peptidase activity
GO:0004175	0.743	endopeptidase activity
GO:0004252	0.717	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.996	regulation of biological process
GO:0032501	0.992	multicellular organismal process
GO:0006950	0.992	response to stress
GO:0030335	0.990	positive regulation of cell migration
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0050817	0.979	coagulation
GO:0050878	0.968	regulation of body fluid levels
GO:0010604	0.964	positive regulation of macromolecule metabolic process
GO:0042127	0.958	regulation of cell population proliferation
GO:0042060	0.954	wound healing
GO:0007599	0.951	hemostasis
GO:0051094	0.936	positive regulation of developmental process
GO:0051239	0.933	regulation of multicellular organismal process
GO:1903034	0.932	regulation of response to wounding
GO:0045766	0.921	positive regulation of angiogenesis
GO:0048584	0.912	positive regulation of response to stimulus
GO:0009987	0.911	cellular process
GO:0008152	0.902	metabolic process
GO:0007596	0.892	blood coagulation
GO:0032101	0.865	regulation of response to external stimulus
GO:0010628	0.862	positive regulation of gene expression
GO:0051247	0.857	positive regulation of protein metabolic process
GO:0044093	0.856	positive regulation of molecular function
GO:0050790	0.839	regulation of catalytic activity
GO:0071704	0.828	organic substance metabolic process
GO:0061041	0.820	regulation of wound healing
GO:0001817	0.797	regulation of cytokine production
GO:0008284	0.781	positive regulation of cell population proliferation
GO:0006952	0.769	defense response
GO:0043085	0.737	positive regulation of catalytic activity
GO:0050818	0.730	regulation of coagulation
GO:0044238	0.719	primary metabolic process
GO:0009967	0.719	positive regulation of signal transduction
GO:1902533	0.706	positive regulation of intracellular signal transduction
GO:0030193	0.691	regulation of blood coagulation
GO:0051716	0.679	cellular response to stimulus
GO:0006807	0.678	nitrogen compound metabolic process
GO:0043170	0.667	macromolecule metabolic process
GO:0019538	0.651	protein metabolic process
GO:0001819	0.644	positive regulation of cytokine production
GO:0030162	0.635	regulation of proteolysis
GO:0051336	0.631	regulation of hydrolase activity
GO:0048519	0.601	negative regulation of biological process
GO:0051345	0.523	positive regulation of hydrolase activity
GO:0032677	0.510	regulation of interleukin-8 production
GO:0050920	0.504	regulation of chemotaxis
GO:0006508	0.500	proteolysis
GO:0052547	0.495	regulation of peptidase activity
GO:0032103	0.492	positive regulation of response to external stimulus
GO:0032502	0.489	developmental process
GO:0007154	0.447	cell communication
GO:0042221	0.441	response to chemical
GO:0006954	0.438	inflammatory response
GO:0051604	0.419	protein maturation
GO:0050678	0.414	regulation of epithelial cell proliferation
GO:0050921	0.406	positive regulation of chemotaxis
GO:0023052	0.405	signaling
GO:0051896	0.405	regulation of protein kinase B signaling
GO:0090303	0.398	positive regulation of wound healing
GO:0051897	0.398	positive regulation of protein kinase B signaling
GO:0001936	0.393	regulation of endothelial cell proliferation
GO:0010033	0.392	response to organic substance
GO:0032757	0.392	positive regulation of interleukin-8 production
GO:0052548	0.385	regulation of endopeptidase activity
GO:0070887	0.381	cellular response to chemical stimulus
GO:0045862	0.380	positive regulation of proteolysis
GO:0043281	0.380	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0031323	0.372	regulation of cellular metabolic process
GO:0050926	0.370	regulation of positive chemotaxis
GO:0007165	0.369	signal transduction
GO:0010950	0.361	positive regulation of endopeptidase activity
GO:0043280	0.352	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0031325	0.336	positive regulation of cellular metabolic process
GO:0009605	0.326	response to external stimulus
GO:0048585	0.305	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005886	0.999	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0009986	0.992	cell surface
GO:0012505	0.954	endomembrane system
GO:0043227	0.953	membrane-bounded organelle
GO:0005622	0.929	intracellular anatomical structure
GO:0005737	0.916	cytoplasm
GO:0031982	0.911	vesicle
GO:0031012	0.845	extracellular matrix
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0062023	0.826	collagen-containing extracellular matrix
GO:0098552	0.754	side of membrane
GO:0009897	0.744	external side of plasma membrane
GO:1902494	0.696	catalytic complex
GO:1905369	0.581	endopeptidase complex
GO:1905370	0.542	serine-type endopeptidase complex
GO:0043230	0.521	extracellular organelle
GO:0070013	0.419	intracellular organelle lumen
GO:1903561	0.389	extracellular vesicle
GO:0070062	0.358	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.961	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.717	Serine endopeptidases.

[back to server]