StarFunc result for job id P13727

User Input

>input (222 residues)
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
AWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13727	1.000	1.000	5.455E-41	222	1.000	1.000	P13727.pdb.gz	PRG2_HUMAN Bone marrow proteoglycan OS=Homo sapiens OX=9606 GN=PRG2 PE=1 SV=2
2	AFDB:Q61878	0.652	0.649	2.745E-28	223	0.599	0.596	Q61878.pdb.gz	PRG2_MOUSE Bone marrow proteoglycan OS=Mus musculus OX=10090 GN=Prg2 PE=1 SV=1
3	AFDB:Q9Y2Y8	0.616	0.608	3.638E-24	225	0.505	0.498	Q9Y2Y8.pdb.gz	PRG3_HUMAN Proteoglycan 3 OS=Homo sapiens OX=9606 GN=PRG3 PE=1 SV=2
4	PDB:1qddA	0.494	0.740	2.321E-10	144	0.153	0.236	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
5	AFDB:P43137	0.497	0.657	2.642E-10	165	0.162	0.218	P43137.pdb.gz	LIT1_MOUSE Lithostathine-1 OS=Mus musculus OX=10090 GN=Reg1 PE=1 SV=1
6	AFDB:P48304	0.498	0.656	2.804E-10	166	0.158	0.211	P48304.pdb.gz	REG1B_HUMAN Lithostathine-1-beta OS=Homo sapiens OX=9606 GN=REG1B PE=1 SV=1
7	AFDB:P05451	0.498	0.655	5.075E-10	166	0.158	0.211	P05451.pdb.gz	REG1A_HUMAN Lithostathine-1-alpha OS=Homo sapiens OX=9606 GN=REG1A PE=1 SV=3
8	AFDB:Q08731	0.502	0.637	7.244E-10	173	0.176	0.225	Q08731.pdb.gz	LIT2_MOUSE Lithostathine-2 OS=Mus musculus OX=10090 GN=Reg2 PE=1 SV=1
9	AFDB:Q9XX56	0.501	0.692	9.745E-10	158	0.162	0.228	Q9XX56.pdb.gz	Q9XX56_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y38H6C.8 PE=1 SV=1
10	AFDB:P10758	0.476	0.627	1.034E-9	165	0.176	0.236	P10758.pdb.gz	LITH_RAT Lithostathine OS=Rattus norvegicus OX=10116 GN=Reg1 PE=1 SV=1
11	AFDB:Q18821	0.487	0.645	3.192E-9	166	0.176	0.235	Q18821.pdb.gz	Q18821_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-86 PE=4 SV=1
12	PDB:5f2qB	0.487	0.776	1.164E-8	135	0.158	0.259	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
13	PDB:4mthA	0.492	0.762	4.295E-8	139	0.149	0.237	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
14	PDB:1gz2A	0.424	0.646	5.188E-7	139	0.167	0.266	1gz2A.pdb.gz
15	PDB:7qsrA	0.470	0.085	5.505E-7	1335	0.122	0.020	7qsrA.pdb.gz
16	PDB:1htnA	0.408	0.563	5.842E-7	156	0.113	0.160	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
17	PDB:1bj3A	0.392	0.643	6.980E-7	129	0.131	0.225	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
18	PDB:7jptA	0.439	0.082	9.390E-7	1327	0.144	0.024	7jptA.pdb.gz
19	PDB:2kv3A	0.423	0.667	1.263E-6	131	0.131	0.221	2kv3A.pdb.gz
20	PDB:7wz8A	0.444	0.536	4.391E-6	180	0.113	0.139	7wz8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13727	2.08e-167	461	222	1.000	1.000	PRG2_HUMAN Bone marrow proteoglycan OS=Homo sapiens OX=9606 GN=PRG2 PE=1 SV=2
2	Q61878	9.69e-82	244	223	0.604	0.601	PRG2_MOUSE Bone marrow proteoglycan OS=Mus musculus OX=10090 GN=Prg2 PE=1 SV=1
3	Q9Y2Y8	1.94e-66	206	225	0.482	0.476	PRG3_HUMAN Proteoglycan 3 OS=Homo sapiens OX=9606 GN=PRG3 PE=1 SV=2
4	Q17452	1.17e-07	53.5	308	0.153	0.110	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
5	Q60767	1.23e-06	50.8	1723	0.135	0.017	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
6	O60449	4.52e-06	49.3	1722	0.140	0.018	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
7	Q9XX56	1.70e-05	45.8	158	0.176	0.247	Q9XX56_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y38H6C.8 PE=1 SV=1
8	P48304	2.72e-05	45.4	166	0.158	0.211	REG1B_HUMAN Lithostathine-1-beta OS=Homo sapiens OX=9606 GN=REG1B PE=1 SV=1
9	Q08731	2.87e-05	45.4	173	0.180	0.231	LIT2_MOUSE Lithostathine-2 OS=Mus musculus OX=10090 GN=Reg2 PE=1 SV=1
10	Q18821	3.03e-05	45.1	166	0.167	0.223	Q18821_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-86 PE=4 SV=1
11	Q61830	6.57e-05	45.8	1456	0.194	0.030	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
12	Q4LDF5	1.15e-04	45.1	1732	0.135	0.017	Q4LDF5_CHICK DEC-205 protein OS=Gallus gallus OX=9031 GN=DEC205 PE=2 SV=1
13	P43137	1.28e-04	43.5	165	0.167	0.224	LIT1_MOUSE Lithostathine-1 OS=Mus musculus OX=10090 GN=Reg1 PE=1 SV=1
14	P0DJL3	1.85e-04	42.0	123	0.126	0.228	SLB_TRIPP Snaclec purpureotin subunit beta OS=Trimeresurus purpureomaculatus OX=101163 PE=1 SV=1
15	Q9UBG0	3.60e-04	43.5	1479	0.162	0.024	MRC2_HUMAN C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2
16	P22897	6.56e-04	42.7	1456	0.153	0.023	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
17	O14594	6.80e-04	42.7	1321	0.158	0.026	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
18	Q4TU93	8.40e-04	42.4	1480	0.153	0.023	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
19	Q64449	0.001	42.4	1479	0.158	0.024	MRC2_MOUSE C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3
20	Q22955	0.003	40.4	417	0.153	0.082	Q22955_CAEEL C-type LECtin OS=Caenorhabditis elegans OX=6239 GN=clec-7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15429 DUF4628	1.1e+02	13.8	Domain of unknown function (DUF4628)
2	PF00059 Lectin_C	2.7e-07	42.6	Lectin C-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000330658	0.996	Pappalysin-1
2	9606.ENSP00000355627	0.966	Angiotensinogen
3	9606.ENSP00000303276	0.766	Non-secretory ribonuclease
4	9606.ENSP00000353259	0.751	CMRF35-like molecule 8
5	9606.ENSP00000225371	0.743	Eosinophil peroxidase
6	9606.ENSP00000302324	0.738	Eosinophil cationic protein
7	9606.ENSP00000283632	0.677	Protein RMD5 homolog A
8	9606.ENSP00000368835	0.669	Protein yippee-like 5
9	9606.ENSP00000269593	0.646	Insulin-like growth factor-binding protein 4
10	9606.ENSP00000341838	0.572	Troponin I, cardiac muscle
11	9606.ENSP00000466090	0.513	Neutrophil elastase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent
GO:0030246	0.999	carbohydrate binding
GO:0030021	0.615	extracellular matrix structural constituent conferring compression resistance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0048518	0.988	positive regulation of biological process
GO:0050896	0.986	response to stimulus
GO:0051239	0.962	regulation of multicellular organismal process
GO:0001817	0.940	regulation of cytokine production
GO:0048519	0.930	negative regulation of biological process
GO:0009987	0.919	cellular process
GO:0010628	0.911	positive regulation of gene expression
GO:0050794	0.874	regulation of cellular process
GO:0010605	0.864	negative regulation of macromolecule metabolic process
GO:0010629	0.794	negative regulation of gene expression
GO:0009605	0.736	response to external stimulus
GO:0006950	0.691	response to stress
GO:0006952	0.683	defense response
GO:0051240	0.674	positive regulation of multicellular organismal process
GO:0044419	0.673	biological process involved in interspecies interaction between organisms
GO:0008152	0.553	metabolic process
GO:0071704	0.534	organic substance metabolic process
GO:0032501	0.528	multicellular organismal process
GO:0043207	0.525	response to external biotic stimulus
GO:0051707	0.519	response to other organism
GO:0048523	0.491	negative regulation of cellular process
GO:0001819	0.475	positive regulation of cytokine production
GO:0098542	0.452	defense response to other organism
GO:0006807	0.448	nitrogen compound metabolic process
GO:0044237	0.421	cellular metabolic process
GO:0002376	0.406	immune system process
GO:0031323	0.380	regulation of cellular metabolic process
GO:0051171	0.368	regulation of nitrogen compound metabolic process
GO:0048522	0.354	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0031982	0.996	vesicle
GO:0070013	0.996	intracellular organelle lumen
GO:0005576	0.986	extracellular region
GO:0030141	0.985	secretory granule
GO:0070062	0.912	extracellular exosome
GO:0101002	0.609	ficolin-1-rich granule
GO:0034774	0.608	secretory granule lumen
GO:1904813	0.375	ficolin-1-rich granule lumen
GO:0031981	0.317	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]