StarFunc result for job id P13762

User Input

>input (266 residues)
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYI
YNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTV
QRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLL
FLGTGLFIYFRNQKGHSGLQPTGLLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13762	1.000	1.000	2.113E-50	266	1.000	1.000	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
2	AFDB:Q30154	0.853	0.853	1.502E-45	266	0.861	0.861	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
3	AFDB:A0A0G4PYZ0	0.841	0.841	2.012E-43	266	0.872	0.872	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
4	AFDB:P79483	0.792	0.792	3.719E-42	266	0.846	0.846	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
5	AFDB:P04230	0.808	0.814	1.569E-40	264	0.714	0.720	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
6	AFDB:P18211	0.709	0.714	8.177E-40	264	0.699	0.705	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
7	AFDB:P05538	0.803	0.797	2.842E-35	268	0.624	0.619	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
8	AFDB:P29826	0.738	0.746	7.242E-35	263	0.598	0.605	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
9	AFDB:P01921	0.742	0.744	1.327E-34	265	0.609	0.611	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
10	AFDB:P01920	0.807	0.821	3.029E-34	261	0.602	0.613	P01920.pdb.gz	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
11	PDB:6cplA	0.391	0.564	1.750E-14	180	0.154	0.228	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:3es6A	0.530	0.512	1.971E-13	277	0.177	0.170	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:5j6hA	0.501	0.488	3.088E-12	275	0.184	0.178	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6d7gA	0.449	0.338	1.442E-11	386	0.173	0.119	6d7gA.pdb.gz
15	PDB:6mp0A	0.483	0.356	1.609E-11	388	0.165	0.113	6mp0A.pdb.gz
16	PDB:6fgbA	0.521	0.523	3.882E-11	265	0.150	0.151	6fgbA.pdb.gz
17	PDB:6e1iA	0.471	0.351	4.838E-11	389	0.173	0.118	6e1iA.pdb.gz
18	PDB:3s6cA	0.512	0.381	2.664E-10	372	0.165	0.118	3s6cA.pdb.gz
19	PDB:2qriA	0.518	0.367	3.320E-10	398	0.177	0.118	2qriA.pdb.gz
20	PDB:3ov6A	0.548	0.404	4.138E-10	376	0.158	0.112	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13762	0.0	553	266	1.000	1.000	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
2	P01911	1.26e-165	461	266	0.876	0.876	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
3	A0A0G4PYZ0	1.79e-164	457	266	0.872	0.872	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
4	Q30154	8.39e-162	451	266	0.861	0.861	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
5	P79483	6.80e-159	444	266	0.846	0.846	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
6	P18468	5.37e-142	401	264	0.707	0.712	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
7	P18469	7.56e-138	390	264	0.726	0.731	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
8	P04230	8.71e-134	380	264	0.714	0.720	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
9	P18211	3.18e-130	371	264	0.699	0.705	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
10	P04231	6.93e-123	351	232	0.658	0.754	HB23_MOUSE H-2 class II histocompatibility antigen, E-S beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
11	P06342	2.43e-116	336	265	0.613	0.615	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
12	P01921	4.09e-115	333	265	0.613	0.615	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
13	P14483	2.38e-114	331	265	0.613	0.615	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
14	P06345	5.94e-112	325	263	0.609	0.616	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
15	P06346	4.36e-111	322	252	0.598	0.631	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
16	P01920	1.56e-109	318	261	0.602	0.613	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
17	P05538	4.27e-109	318	268	0.624	0.619	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
18	P29826	1.10e-108	316	263	0.594	0.601	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
19	A0A1C3PI11	2.32e-108	315	258	0.564	0.581	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
20	Q30059	3.51e-108	315	258	0.575	0.593	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3e-23	93.3	Immunoglobulin C1-set domain
2	PF02656 DUF202	1.7e+02	14.1	Domain of unknown function (DUF202)
3	PF00047 ig	1.6	20.3	Immunoglobulin domain
4	PF13927 Ig_3	0.029	26.2	Immunoglobulin domain
5	PF00969 MHC_II_beta	4.2e-32	121.4	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000016035

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000012377	0.977	Major histocompatibility complex, class II, DR alpha
2	9555.ENSPANP00000000660	0.938	CD74 molecule, major histocompatibility complex, class II invariant chain
3	9555.ENSPANP00000012378	0.935	Belongs to the MHC class II family.
4	9555.ENSPANP00000012393	0.926	annotation not available
5	9555.ENSPANP00000012394	0.924	Major histocompatibility complex, class II, DM alpha
6	9555.ENSPANP00000017788	0.841	annotation not available
7	9555.ENSPANP00000012379	0.836	annotation not available
8	9555.ENSPANP00000012398	0.834	Major histocompatibility complex, class II, DO alpha
9	9555.ENSPANP00000012400	0.804	Major histocompatibility complex, class II, DP alpha 1
10	9555.ENSPANP00000004160	0.801	CD4 molecule
11	9555.ENSPANP00000011192	0.741	Protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
12	9555.ENSPANP00000004702	0.681	Papio anubis CD247 molecule (CD247), mRNA
13	9555.ENSPANP00000010755	0.668	Protein tyrosine phosphatase, receptor type, C
14	9555.ENSPANP00000012383	0.665	Major histocompatibility complex, class II, DO beta
15	9555.ENSPANP00000011476	0.660	Papio anubis CD86 molecule (CD86), mRNA
16	9555.ENSPANP00000015332	0.650	CD80 molecule
17	9555.ENSPANP00000011738	0.643	Cathepsin S
18	9555.ENSPANP00000001916	0.627	CD3e molecule, epsilon (CD3-TCR complex)
19	9555.ENSPANP00000011679	0.614	Papio anubis CD28 molecule (CD28), mRNA
20	9555.ENSPANP00000003262	0.593	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.831	protein-containing complex binding
GO:0038023	0.807	signaling receptor activity
GO:0004888	0.763	transmembrane signaling receptor activity
GO:0003823	0.608	antigen binding
GO:0140375	0.494	immune receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0002504	0.992	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0050896	0.988	response to stimulus
GO:0019884	0.985	antigen processing and presentation of exogenous antigen
GO:0002495	0.976	antigen processing and presentation of peptide antigen via MHC class II
GO:0019886	0.974	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0009987	0.907	cellular process
GO:0065007	0.903	biological regulation
GO:0050794	0.890	regulation of cellular process
GO:0006955	0.885	immune response
GO:0007165	0.860	signal transduction
GO:0048518	0.781	positive regulation of biological process
GO:0048583	0.758	regulation of response to stimulus
GO:0002682	0.722	regulation of immune system process
GO:0050776	0.713	regulation of immune response
GO:0048584	0.708	positive regulation of response to stimulus
GO:0007166	0.707	cell surface receptor signaling pathway
GO:0048522	0.699	positive regulation of cellular process
GO:0002684	0.624	positive regulation of immune system process
GO:0050778	0.586	positive regulation of immune response
GO:0051251	0.558	positive regulation of lymphocyte activation
GO:1903037	0.553	regulation of leukocyte cell-cell adhesion
GO:0045785	0.552	positive regulation of cell adhesion
GO:0002764	0.540	immune response-regulating signaling pathway
GO:0050863	0.538	regulation of T cell activation
GO:1903039	0.537	positive regulation of leukocyte cell-cell adhesion
GO:0050870	0.534	positive regulation of T cell activation
GO:0002429	0.521	immune response-activating cell surface receptor signaling pathway
GO:0050852	0.462	T cell receptor signaling pathway
GO:0002250	0.384	adaptive immune response
GO:0019222	0.380	regulation of metabolic process
GO:0042221	0.371	response to chemical
GO:0042127	0.364	regulation of cell population proliferation
GO:0060255	0.363	regulation of macromolecule metabolic process
GO:0010033	0.354	response to organic substance
GO:0009893	0.353	positive regulation of metabolic process
GO:0010604	0.343	positive regulation of macromolecule metabolic process
GO:0050670	0.306	regulation of lymphocyte proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0098552	0.995	side of membrane
GO:0005764	0.992	lysosome
GO:0005768	0.991	endosome
GO:0032991	0.983	protein-containing complex
GO:0005765	0.982	lysosomal membrane
GO:0005789	0.977	endoplasmic reticulum membrane
GO:0005770	0.975	late endosome
GO:0098553	0.973	lumenal side of endoplasmic reticulum membrane
GO:0005802	0.968	trans-Golgi network
GO:0010008	0.968	endosome membrane
GO:0012507	0.966	ER to Golgi transport vesicle membrane
GO:0045334	0.965	clathrin-coated endocytic vesicle
GO:0000139	0.964	Golgi membrane
GO:0032588	0.962	trans-Golgi network membrane
GO:0030669	0.962	clathrin-coated endocytic vesicle membrane
GO:0031902	0.925	late endosome membrane
GO:0098796	0.827	membrane protein complex
GO:0098797	0.819	plasma membrane protein complex
GO:0042613	0.617	MHC class II protein complex
GO:0009986	0.517	cell surface
GO:0005576	0.461	extracellular region
GO:0070062	0.413	extracellular exosome
GO:0009897	0.394	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]