StarFunc result for job id P13765

User Input

>input (273 residues)
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13765	1.000	1.000	1.123E-48	273	1.000	1.000	P13765.pdb.gz	DOB_HUMAN HLA class II histocompatibility antigen, DO beta chain OS=Homo sapiens OX=9606 GN=HLA-DOB PE=1 SV=1
2	AFDB:P13762	0.681	0.697	3.812E-32	266	0.513	0.526	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
3	AFDB:Q30154	0.693	0.710	8.925E-32	266	0.516	0.530	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
4	AFDB:P04230	0.617	0.636	1.879E-31	264	0.495	0.511	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
5	AFDB:P05538	0.630	0.641	4.398E-31	268	0.513	0.522	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
6	AFDB:P18211	0.570	0.586	9.256E-31	264	0.451	0.466	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
7	AFDB:P29826	0.581	0.600	2.285E-30	263	0.509	0.529	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
8	AFDB:P01921	0.748	0.769	2.542E-30	265	0.498	0.513	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
9	AFDB:A0A0G4PYZ0	0.693	0.710	3.497E-30	266	0.502	0.515	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
10	AFDB:P79483	0.663	0.679	2.021E-29	266	0.502	0.515	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
11	PDB:6cplA	0.370	0.552	4.415E-14	180	0.158	0.239	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:5j6hA	0.412	0.411	1.054E-11	275	0.165	0.164	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:6fgbA	0.451	0.462	1.054E-11	265	0.161	0.166	6fgbA.pdb.gz
14	PDB:3es6A	0.470	0.465	1.701E-11	277	0.172	0.170	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
15	PDB:6mp0A	0.386	0.300	3.053E-11	388	0.168	0.119	6mp0A.pdb.gz
16	PDB:6e1iA	0.386	0.299	1.352E-10	389	0.154	0.108	6e1iA.pdb.gz
17	PDB:3ov6A	0.451	0.348	1.962E-10	376	0.183	0.133	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
18	PDB:6d7gA	0.375	0.291	2.302E-10	386	0.132	0.093	6d7gA.pdb.gz
19	PDB:3s6cA	0.434	0.339	2.847E-10	372	0.165	0.121	3s6cA.pdb.gz
20	PDB:2qriA	0.443	0.328	4.844E-10	398	0.165	0.113	2qriA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13765	0.0	567	273	1.000	1.000	DOB_HUMAN HLA class II histocompatibility antigen, DO beta chain OS=Homo sapiens OX=9606 GN=HLA-DOB PE=1 SV=1
2	E7ENX8	5.18e-119	362	843	0.623	0.202	E7ENX8_HUMAN ABC-type antigen peptide transporter (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
3	P01920	8.79e-97	286	261	0.527	0.552	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
4	P18468	1.85e-96	286	264	0.498	0.515	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
5	P01911	3.34e-96	285	266	0.527	0.541	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
6	P14483	7.02e-96	284	265	0.509	0.525	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
7	P04440	1.85e-95	283	258	0.495	0.523	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
8	P01921	3.13e-95	283	265	0.502	0.517	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
9	P13762	1.21e-94	281	266	0.513	0.526	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
10	P06342	2.52e-94	280	265	0.509	0.525	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
11	Q30154	2.16e-93	278	266	0.513	0.526	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
12	A0A1C3PI11	5.15e-93	276	258	0.491	0.519	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
13	Q95HA4	5.38e-93	276	257	0.491	0.521	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
14	P29826	7.82e-93	276	263	0.509	0.529	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
15	A0A0G4PYZ0	1.16e-91	273	266	0.505	0.519	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
16	P79483	1.79e-91	273	266	0.505	0.519	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
17	Q30059	2.37e-91	272	258	0.484	0.512	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
18	P05538	5.64e-91	272	268	0.516	0.526	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
19	P04230	6.56e-91	271	264	0.502	0.519	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
20	P06343	3.05e-90	270	263	0.487	0.506	HB2K_MOUSE H-2 class II histocompatibility antigen, A-K beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.2e-21	87.3	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	66	15.0	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	10	17.7	Immunoglobulin domain
4	PF00129 MHC_I	71	14.4	Class I Histocompatibility antigen, domains alpha 1 and 2
5	PF00969 MHC_II_beta	3.4e-31	118.5	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390020

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363976	0.989	HLA class II histocompatibility antigen, DM alpha chain
2	9606.ENSP00000229829	0.950	HLA class II histocompatibility antigen, DO alpha chain
3	9606.ENSP00000398890	0.948	HLA class II histocompatibility antigen, DM beta chain
4	9606.ENSP00000009530	0.938	HLA class II histocompatibility antigen gamma chain
5	9606.ENSP00000378786	0.936	HLA class II histocompatibility antigen, DR alpha chain
6	9606.ENSP00000393566	0.933	HLA class II histocompatibility antigen, DP alpha 1 chain
7	9606.ENSP00000259951	0.925	HLA class I histocompatibility antigen, alpha chain F
8	9606.ENSP00000399168	0.925	HLA class I histocompatibility antigen, B-7 alpha chain
9	9606.ENSP00000365402	0.923	HLA class I histocompatibility antigen, Cw-7 alpha chain
10	9606.ENSP00000379873	0.922	HLA class I histocompatibility antigen, A-3 alpha chain
11	9606.ENSP00000365817	0.921	HLA class I histocompatibility antigen, alpha chain E
12	9606.ENSP00000353099	0.914	HLA class II histocompatibility antigen, DRB1-15 beta chain
13	9606.ENSP00000408146	0.912	HLA class II histocompatibility antigen, DP beta 1 chain
14	9606.ENSP00000390431	0.909	Major histocompatibility complex, class II, DQ beta 2
15	9606.ENSP00000339398	0.786	Major histocompatibility complex, class II, DQ alpha 1
16	9606.ENSP00000364016	0.785	Proteasome subunit beta type-8
17	9606.ENSP00000363993	0.782	Proteasome subunit beta type-9
18	9606.ENSP00000364080	0.754	HLA class II histocompatibility antigen, DQ beta 1 chain
19	9606.ENSP00000452780	0.752	Beta-2-microglobulin
20	9606.ENSP00000364114	0.739	HLA class II histocompatibility antigen, DR beta 5 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0033218	0.937	amide binding
GO:0042277	0.934	peptide binding
GO:0044877	0.846	protein-containing complex binding
GO:0042605	0.781	peptide antigen binding
GO:0023023	0.681	MHC protein complex binding
GO:0038023	0.577	signaling receptor activity
GO:0140375	0.539	immune receptor activity
GO:0032395	0.525	MHC class II receptor activity
GO:0023026	0.303	MHC class II protein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.980	regulation of biological process
GO:0002376	0.956	immune system process
GO:0050794	0.915	regulation of cellular process
GO:0002682	0.902	regulation of immune system process
GO:0019882	0.876	antigen processing and presentation
GO:0050896	0.833	response to stimulus
GO:0048002	0.819	antigen processing and presentation of peptide antigen
GO:0048519	0.750	negative regulation of biological process
GO:0019884	0.731	antigen processing and presentation of exogenous antigen
GO:0048518	0.721	positive regulation of biological process
GO:0002478	0.717	antigen processing and presentation of exogenous peptide antigen
GO:0002683	0.659	negative regulation of immune system process
GO:0009987	0.651	cellular process
GO:0048583	0.631	regulation of response to stimulus
GO:0002495	0.629	antigen processing and presentation of peptide antigen via MHC class II
GO:0050776	0.516	regulation of immune response
GO:0006955	0.499	immune response
GO:0019886	0.491	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0002684	0.488	positive regulation of immune system process
GO:0048522	0.421	positive regulation of cellular process
GO:0051249	0.355	regulation of lymphocyte activation
GO:0048584	0.349	positive regulation of response to stimulus
GO:0050778	0.341	positive regulation of immune response
GO:0048523	0.334	negative regulation of cellular process
GO:0019222	0.304	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0098588	0.997	bounding membrane of organelle
GO:0098797	0.995	plasma membrane protein complex
GO:0012505	0.993	endomembrane system
GO:0042613	0.988	MHC class II protein complex
GO:0000323	0.968	lytic vacuole
GO:0005764	0.963	lysosome
GO:0005765	0.950	lysosomal membrane
GO:0031982	0.930	vesicle
GO:0009986	0.923	cell surface
GO:0030659	0.920	cytoplasmic vesicle membrane
GO:0005794	0.918	Golgi apparatus
GO:0005768	0.917	endosome
GO:0030662	0.880	coated vesicle membrane
GO:0098552	0.878	side of membrane
GO:0031984	0.853	organelle subcompartment
GO:0005783	0.824	endoplasmic reticulum
GO:0030139	0.818	endocytic vesicle
GO:0042175	0.809	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0030666	0.809	endocytic vesicle membrane
GO:0098827	0.799	endoplasmic reticulum subcompartment
GO:0030665	0.797	clathrin-coated vesicle membrane
GO:0098791	0.793	Golgi apparatus subcompartment
GO:0005789	0.788	endoplasmic reticulum membrane
GO:0000139	0.747	Golgi membrane
GO:0045334	0.696	clathrin-coated endocytic vesicle
GO:0030669	0.694	clathrin-coated endocytic vesicle membrane
GO:0005802	0.568	trans-Golgi network
GO:0010008	0.553	endosome membrane
GO:0005770	0.526	late endosome
GO:0030133	0.506	transport vesicle
GO:0030134	0.502	COPII-coated ER to Golgi transport vesicle
GO:0032588	0.500	trans-Golgi network membrane
GO:0098553	0.477	lumenal side of endoplasmic reticulum membrane
GO:0012507	0.450	ER to Golgi transport vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]