StarFunc result for job id P13804

User Input

>input (333 residues)
MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKC
DKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSG
GSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQ
LHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAIN
KDPEAPIFQVADYGIVADLFKVVPEMTEILKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z3L0	0.994	0.994	1.235E-68	333	1.000	1.000	A0A0S2Z3L0.pdb.gz	A0A0S2Z3L0_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ETFA PE=2 SV=1
2	PDB:2a1uA	0.942	0.995	4.885E-62	315	0.946	1.000	2a1uA.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
3	AFDB:H0YLU7	0.889	0.977	2.826E-59	303	0.904	0.993	H0YLU7.pdb.gz	H0YLU7_HUMAN Electron transfer flavoprotein subunit alpha OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=2
4	AFDB:Q7ZUS9	0.962	0.962	1.028E-58	333	0.799	0.799	Q7ZUS9.pdb.gz	Q7ZUS9_DANRE Electron transfer flavoprotein subunit alpha OS=Danio rerio OX=7955 GN=wu:fd06h11 PE=1 SV=1
5	AFDB:Q7KLW5	0.937	0.918	5.004E-53	340	0.682	0.668	Q7KLW5.pdb.gz	Q7KLW5_DROME LD07532p (Fragment) OS=Drosophila melanogaster OX=7227 GN=wal PE=2 SV=1
6	AFDB:Q93615	0.929	0.932	6.022E-49	332	0.631	0.633	Q93615.pdb.gz	ETFA_CAEEL Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F27D4.1 PE=3 SV=2
7	AFDB:Q384Q2	0.921	0.946	2.798E-44	324	0.480	0.494	Q384Q2.pdb.gz	Q384Q2_TRYB2 Electron transfer flavoprotein subunit alpha OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5530 PE=3 SV=1
8	AFDB:Q12480	0.921	0.892	5.783E-41	344	0.453	0.439	Q12480.pdb.gz	ETFA_YEAST Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM45 PE=1 SV=1
9	AFDB:Q9C6I6	0.899	0.827	1.103E-40	363	0.480	0.441	Q9C6I6.pdb.gz	ETFA_ARATH Electron transfer flavoprotein subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFA PE=1 SV=1
10	AFDB:P78790	0.924	0.902	7.661E-40	341	0.432	0.422	P78790.pdb.gz	ETFA_SCHPO Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27D7.06 PE=2 SV=3
11	AFDB:P9WNG9	0.808	0.843	5.693E-35	318	0.390	0.409	P9WNG9.pdb.gz	ETFA_MYCTU Electron transfer flavoprotein subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=etfA PE=1 SV=1
12	PDB:6fahE	0.586	0.506	1.328E-28	393	0.327	0.277	6fahE.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
13	PDB:2a1uB	0.406	0.524	1.952E-7	252	0.087	0.115	2a1uB.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
14	PDB:2panA	0.298	0.174	7.442E-6	592	0.159	0.090	2panA.pdb.gz	Glyoxylate carboligase lacks the canonical active site glutamate of thiamine-dependent enzymes.
15	PDB:6ijaD	0.301	0.268	2.115E-4	389	0.129	0.111	6ijaD.pdb.gz	Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-beta-l-rhamnose and rhamnosylation mechanism.
16	PDB:2ihvA	0.234	0.145	3.588E-4	563	0.165	0.098	2ihvA.pdb.gz	Structural and mechanistic studies on N(2)-(2-carboxyethyl)arginine synthase.
17	PDB:6u9dR	0.223	0.182	1.095E-3	416	0.138	0.111	6u9dR.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
18	PDB:3flmA	0.214	0.139	2.215E-3	535	0.114	0.071	3flmA.pdb.gz
19	PDB:5ej4A	0.225	0.144	2.215E-3	556	0.108	0.065	5ej4A.pdb.gz	A Thiamine-Dependent Enzyme Utilizes an Active Tetrahedral Intermediate in Vitamin K Biosynthesis
20	PDB:3u31A	0.234	0.288	3.342E-3	263	0.087	0.110	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3L0	0.0	676	333	1.000	1.000	A0A0S2Z3L0_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ETFA PE=2 SV=1
2	H0YKF0	0.0	552	301	0.817	0.904	H0YKF0_HUMAN Electron transfer flavoprotein subunit alpha OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=2
3	P13804	0.0	676	333	1.000	1.000	ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1
4	Q7ZUS9	0.0	552	333	0.805	0.805	Q7ZUS9_DANRE Electron transfer flavoprotein subunit alpha OS=Danio rerio OX=7955 GN=wu:fd06h11 PE=1 SV=1
5	Q99LC5	0.0	630	333	0.958	0.958	ETFA_MOUSE Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Etfa PE=1 SV=2
6	Q7KN94	3.09e-161	455	330	0.679	0.685	Q7KN94_DROME Electron transfer flavoprotein subunit alpha OS=Drosophila melanogaster OX=7227 GN=wal PE=1 SV=1
7	Q7KLW5	3.47e-161	455	340	0.679	0.665	Q7KLW5_DROME LD07532p (Fragment) OS=Drosophila melanogaster OX=7227 GN=wal PE=2 SV=1
8	H0YLU7	1.19e-157	449	406	0.664	0.544	H0YLU7_HUMAN Electron transfer flavoprotein subunit alpha OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=2
9	H0YK49	8.26e-156	437	229	0.649	0.943	H0YK49_HUMAN Electron transfer flavoprotein subunit alpha OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1
10	Q93615	3.13e-144	412	332	0.607	0.608	ETFA_CAEEL Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F27D4.1 PE=3 SV=2
11	Q384Q2	1.07e-104	311	324	0.471	0.485	Q384Q2_TRYB2 Electron transfer flavoprotein subunit alpha OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5530 PE=3 SV=1
12	Q9C6I6	5.75e-102	306	363	0.492	0.452	ETFA_ARATH Electron transfer flavoprotein subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFA PE=1 SV=1
13	P78790	5.20e-94	285	341	0.438	0.428	ETFA_SCHPO Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27D7.06 PE=2 SV=3
14	Q12480	2.27e-93	283	344	0.474	0.459	ETFA_YEAST Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM45 PE=1 SV=1
15	P9WNG9	6.66e-70	222	318	0.402	0.421	ETFA_MYCTU Electron transfer flavoprotein subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=etfA PE=1 SV=1
16	H6LGM8	5.06e-45	160	396	0.333	0.280	CARE_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarE OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carE PE=1 SV=1
17	H0YL83	1.54e-44	149	73	0.219	1.000	H0YL83_HUMAN Electron transfer flavoprotein subunit alpha OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1
18	G3KIM6	1.42e-37	139	367	0.333	0.302	ETFA_ANAPI Acryloyl-CoA reductase electron transfer subunit beta OS=Anaerotignum propionicum OX=28446 GN=acrA PE=1 SV=1
19	P31574	4.16e-29	115	313	0.246	0.262	FIXB_ECOLI Protein FixB OS=Escherichia coli (strain K12) OX=83333 GN=fixB PE=1 SV=3
20	Q06440	0.74	34.3	651	0.048	0.025	CORO_YEAST Coronin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01012 ETF	1.8e-35	133.9	Electron transfer flavoprotein domain
2	PF00766 ETF_alpha	2.2e-33	125.5	Electron transfer flavoprotein FAD-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346173	0.999	Electron transfer flavoprotein subunit beta
2	9606.ENSP00000426638	0.999	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
3	9606.ENSP00000359871	0.980	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000327070	0.962	Malate dehydrogenase, mitochondrial
5	9606.ENSP00000357535	0.947	Enoyl-CoA hydratase, mitochondrial
6	9606.ENSP00000370761	0.940	Electron transfer flavoprotein regulatory factor 1
7	9606.ENSP00000196371	0.912	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
8	9606.ENSP00000349687	0.901	Ganglioside GM2 activator
9	9606.ENSP00000381736	0.879	ATP synthase subunit alpha, mitochondrial
10	9606.ENSP00000233893	0.869	10 kDa heat shock protein, mitochondrial
11	9606.ENSP00000242592	0.852	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
12	9606.ENSP00000418397	0.843	Isovaleryl-CoA dehydrogenase, mitochondrial
13	9606.ENSP00000474560	0.840	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
14	9606.ENSP00000438144	0.836	Malate dehydrogenase, cytoplasmic
15	9606.ENSP00000438689	0.827	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000361914	0.821	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
17	9606.ENSP00000281182	0.810	Isobutyryl-CoA dehydrogenase, mitochondrial
18	9606.ENSP00000173527	0.804	Isochorismatase domain containing 1
19	9606.ENSP00000261070	0.800	Cytochrome c oxidase copper chaperone
20	9606.ENSP00000312618	0.795	Acyl-CoA dehydrogenase family member 9, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0009055	0.999	electron transfer activity
GO:0043167	0.995	ion binding
GO:0097159	0.929	organic cyclic compound binding
GO:1901363	0.923	heterocyclic compound binding
GO:0050660	0.873	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0008152	0.976	metabolic process
GO:0044237	0.932	cellular metabolic process
GO:0071704	0.928	organic substance metabolic process
GO:0044238	0.846	primary metabolic process
GO:0044281	0.806	small molecule metabolic process
GO:0006807	0.529	nitrogen compound metabolic process
GO:0006082	0.502	organic acid metabolic process
GO:1901564	0.438	organonitrogen compound metabolic process
GO:0009056	0.375	catabolic process
GO:0019752	0.375	carboxylic acid metabolic process
GO:0050789	0.357	regulation of biological process
GO:1901575	0.346	organic substance catabolic process
GO:0044248	0.331	cellular catabolic process
GO:0044282	0.306	small molecule catabolic process
GO:0015980	0.303	energy derivation by oxidation of organic compounds
GO:0050794	0.302	regulation of cellular process
GO:0006629	0.300	lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0032991	0.990	protein-containing complex
GO:0005759	0.912	mitochondrial matrix
GO:1902494	0.895	catalytic complex
GO:0016020	0.530	membrane
GO:0098798	0.431	mitochondrial protein-containing complex
GO:0031981	0.326	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.999	Oxidoreductases.

[back to server]