StarFunc result for job id P13805

User Input

>input (278 residues)
MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGER
VDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEK
ERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGRE
MKVRILSERKKPLDIDYMGEEQLRARSAWLPPSQPSCPAREKAQELSDWIHQLESEKFDL
MAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13805	1.000	1.000	1.648E-38	278	1.000	1.000	P13805.pdb.gz	TNNT1_HUMAN Troponin T, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT1 PE=1 SV=4
2	AFDB:P45378	0.420	0.433	7.118E-17	269	0.554	0.572	P45378.pdb.gz	TNNT3_HUMAN Troponin T, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT3 PE=1 SV=3
3	AFDB:P50752	0.329	0.305	1.990E-16	301	0.590	0.545	P50752.pdb.gz	TNNT2_MOUSE Troponin T, cardiac muscle OS=Mus musculus OX=10090 GN=Tnnt2 PE=1 SV=2
4	AFDB:P45379	0.373	0.351	4.849E-16	298	0.554	0.517	P45379.pdb.gz	TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNT2 PE=1 SV=3
5	AFDB:F1QBR1	0.354	0.401	6.554E-15	241	0.453	0.523	F1QBR1.pdb.gz
6	AFDB:Q8AVB1	0.382	0.368	1.301E-14	290	0.486	0.466	Q8AVB1.pdb.gz	Q8AVB1_DANRE Slow troponin T OS=Danio rerio OX=7955 GN=tnnt1 PE=1 SV=1
7	AFDB:A8WGA6	0.367	0.360	1.832E-14	284	0.550	0.539	A8WGA6.pdb.gz	A8WGA6_DANRE Tnnt3b protein OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
8	AFDB:A8E586	0.338	0.334	4.465E-14	282	0.536	0.528	A8E586.pdb.gz
9	AFDB:A0A060WB67	0.374	0.343	2.072E-12	305	0.493	0.449	A0A060WB67.pdb.gz	A0A060WB67_ONCMY Troponin T type 3a (skeletal, fast) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065892001 PE=3 SV=1
10	AFDB:A0A060XT52	0.377	0.414	2.072E-12	243	0.446	0.510	A0A060XT52.pdb.gz	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
11	PDB:7c79B	0.078	0.036	5.880	793	0.076	0.026	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
12	PDB:5lj5O	0.117	0.115	7.222	283	0.090	0.088	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
13	PDB:6hivCi	0.074	0.102	8.870	165	0.040	0.067	6hivCi.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:6qw64A	0.071	0.082	8.870	239	0.054	0.063	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:7t3aM	0.075	0.174	8.870	115	0.058	0.139	7t3aM.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13805	0.0	546	278	1.000	1.000	TNNT1_HUMAN Troponin T, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT1 PE=1 SV=4
2	Q7TNB2	1.54e-127	365	261	0.773	0.824	TNNT1_RAT Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3
3	O88346	1.59e-127	365	262	0.773	0.821	TNNT1_MOUSE Troponin T, slow skeletal muscle OS=Mus musculus OX=10090 GN=Tnnt1 PE=2 SV=3
4	P45378	3.48e-87	263	269	0.536	0.554	TNNT3_HUMAN Troponin T, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT3 PE=1 SV=3
5	P09739	5.10e-87	262	259	0.525	0.564	TNNT3_RAT Troponin T, fast skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt3 PE=1 SV=2
6	P50753	5.35e-86	260	299	0.583	0.542	TNNT2_RAT Troponin T, cardiac muscle OS=Rattus norvegicus OX=10116 GN=Tnnt2 PE=1 SV=2
7	P50752	1.32e-85	259	301	0.586	0.542	TNNT2_MOUSE Troponin T, cardiac muscle OS=Mus musculus OX=10090 GN=Tnnt2 PE=1 SV=2
8	P45379	5.89e-73	227	298	0.554	0.517	TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNT2 PE=1 SV=3
9	Q8AVB1	3.74e-71	222	290	0.478	0.459	Q8AVB1_DANRE Slow troponin T OS=Danio rerio OX=7955 GN=tnnt1 PE=1 SV=1
10	Q7ZZW4	6.60e-70	217	232	0.482	0.578	Q7ZZW4_DANRE Fast muscle troponin T isoform TnnT3b OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
11	A8WGA6	9.66e-69	216	284	0.464	0.454	A8WGA6_DANRE Tnnt3b protein OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
12	F1R0K6	4.72e-67	211	264	0.511	0.538	F1R0K6_DANRE Troponin T type 2a (cardiac) OS=Danio rerio OX=7955 GN=cTnT PE=1 SV=1
13	Q90Y46	3.37e-64	204	282	0.525	0.518	Q90Y46_DANRE Cardiac troponin T OS=Danio rerio OX=7955 GN=tnnt2 PE=1 SV=1
14	Q4QRC7	3.21e-60	193	241	0.421	0.485	Q4QRC7_DANRE Troponin T2d, cardiac OS=Danio rerio OX=7955 GN=zgc:114184 PE=1 SV=1
15	Q9I8U9	1.99e-58	188	230	0.471	0.570	Q9I8U9_DANRE Fast skeletal muscle troponin T OS=Danio rerio OX=7955 GN=tnnt PE=1 SV=1
16	A0A060XT52	1.55e-43	150	243	0.428	0.490	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
17	A0A060WB67	1.35e-41	147	305	0.421	0.384	A0A060WB67_ONCMY Troponin T type 3a (skeletal, fast) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065892001 PE=3 SV=1
18	P19351	1.69e-06	50.8	397	0.263	0.184	TNNT_DROME Troponin T, skeletal muscle OS=Drosophila melanogaster OX=7227 GN=up PE=1 SV=3
19	Q8IDX6	0.002	41.6	3130	0.126	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
20	Q9L7Q2	0.040	38.1	1906	0.191	0.028	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00992 Troponin	7.2e-31	118.6	Troponin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467176

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341838	0.997	Troponin I, cardiac muscle
2	9606.ENSP00000371331	0.993	Troponin I, fast skeletal muscle
3	9606.ENSP00000232975	0.989	Troponin C, slow skeletal and cardiac muscles
4	9606.ENSP00000354488	0.980	Troponin I, slow skeletal muscle
5	9606.ENSP00000361636	0.971	Troponin C, skeletal muscle
6	9606.ENSP00000351022	0.960	Tropomyosin alpha-1 chain
7	9606.ENSP00000236918	0.949	Troponin T, cardiac muscle
8	9606.ENSP00000357516	0.924	Tropomyosin alpha-3 chain
9	9606.ENSP00000367542	0.919	Tropomyosin beta chain
10	9606.ENSP00000278317	0.907	Troponin T, fast skeletal muscle
11	9606.ENSP00000228841	0.893	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
12	9606.ENSP00000386041	0.892	Myosin-6
13	9606.ENSP00000467141	0.879	Titin
14	9606.ENSP00000484342	0.879	Nebulin
15	9606.ENSP00000379210	0.875	Myosin light chain 3
16	9606.ENSP00000307280	0.869	Myosin light chain 1/3, skeletal muscle isoform
17	9606.ENSP00000345230	0.864	Tropomyosin alpha-4 chain
18	9606.ENSP00000347055	0.862	Myosin light chain 4
19	9606.ENSP00000464317	0.836	Myosin-3
20	9606.ENSP00000384330	0.826	Myosin-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005523	1.000	tropomyosin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.993	multicellular organismal process
GO:0050789	0.989	regulation of biological process
GO:0006936	0.954	muscle contraction
GO:0006941	0.925	striated muscle contraction
GO:0044057	0.924	regulation of system process
GO:0009987	0.871	cellular process
GO:0006937	0.845	regulation of muscle contraction
GO:0003009	0.704	skeletal muscle contraction
GO:0048519	0.589	negative regulation of biological process
GO:0048856	0.585	anatomical structure development
GO:0061061	0.450	muscle structure development
GO:0030029	0.409	actin filament-based process
GO:0051241	0.392	negative regulation of multicellular organismal process
GO:0050794	0.356	regulation of cellular process
GO:0016043	0.351	cellular component organization
GO:0009653	0.334	anatomical structure morphogenesis
GO:0006996	0.307	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005861	0.999	troponin complex
GO:0005829	0.995	cytosol
GO:0043227	0.548	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]