StarFunc result for job id P13861

User Input

>input (404 residues)
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCL
VMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13861	1.000	1.000	1.225E-79	404	1.000	1.000	P13861.pdb.gz	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
2	AFDB:P12367	0.842	0.848	3.513E-70	401	0.866	0.873	P12367.pdb.gz	KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2a PE=1 SV=2
3	PDB:3j4qB	0.758	0.800	5.323E-62	382	0.837	0.885	3j4qB.pdb.gz
4	AFDB:A9C3T0	0.788	0.800	8.742E-58	397	0.708	0.720	A9C3T0.pdb.gz	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
5	AFDB:P31322	0.703	0.681	3.521E-56	418	0.681	0.658	P31322.pdb.gz	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
6	AFDB:P81900	0.823	0.880	5.882E-48	377	0.478	0.512	P81900.pdb.gz	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
7	AFDB:P12849	0.773	0.817	3.243E-39	381	0.342	0.362	P12849.pdb.gz	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
8	AFDB:P30625	0.765	0.842	2.441E-37	366	0.314	0.347	P30625.pdb.gz	KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3
9	AFDB:P09456	0.683	0.722	1.200E-36	381	0.347	0.367	P09456.pdb.gz	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
10	PDB:6wjfC	0.644	0.861	1.815E-36	295	0.562	0.769	6wjfC.pdb.gz
11	AFDB:P16905	0.683	0.729	4.970E-36	376	0.319	0.343	P16905.pdb.gz	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
12	AFDB:P07278	0.629	0.612	2.660E-34	416	0.334	0.325	P07278.pdb.gz	KAPR_YEAST cAMP-dependent protein kinase regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCY1 PE=1 SV=4
13	PDB:6byrB	0.658	0.907	4.260E-34	288	0.297	0.417	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:4dinB	0.651	0.755	3.697E-33	345	0.314	0.368	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
15	PDB:5dykA	0.556	0.289	1.369E-24	809	0.188	0.094	5dykA.pdb.gz
16	PDB:2byvE	0.241	0.114	2.790E-17	922	0.158	0.069	2byvE.pdb.gz
17	PDB:4f7zA	0.253	0.113	6.545E-17	946	0.153	0.066	4f7zA.pdb.gz
18	PDB:3i54D	0.275	0.458	2.354E-11	228	0.072	0.127	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
19	PDB:4byyA	0.312	0.535	2.792E-11	226	0.072	0.128	4byyA.pdb.gz
20	PDB:4ev0D	0.266	0.472	2.565E-10	214	0.079	0.150	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9C3T0	0.0	577	397	0.705	0.718	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
2	C1PIG4	0.0	747	401	0.906	0.913	C1PIG4_PIG cAMP-dependent protein kinase regulatory subunit type II alpha OS=Sus scrofa OX=9823 GN=PRKAR2A PE=2 SV=1
3	P00515	0.0	737	401	0.896	0.903	KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2
4	P12367	0.0	706	401	0.871	0.878	KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2a PE=1 SV=2
5	P12368	0.0	700	401	0.864	0.870	KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2a PE=1 SV=4
6	P12369	0.0	540	416	0.676	0.656	KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2b PE=1 SV=3
7	P13861	0.0	833	404	1.000	1.000	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
8	P31322	0.0	542	418	0.673	0.651	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
9	P31323	0.0	543	418	0.671	0.648	KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3
10	P31324	0.0	540	416	0.676	0.656	KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2b PE=1 SV=3
11	Q08BH1	0.0	576	397	0.705	0.718	Q08BH1_DANRE Prkar2aa protein OS=Danio rerio OX=7955 GN=prkar2aa PE=2 SV=1
12	Q6DHZ2	0.0	543	418	0.671	0.648	Q6DHZ2_HUMAN Protein kinase, cAMP-dependent, regulatory, type II, beta OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=1
13	P81900	1.66e-125	369	377	0.478	0.512	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
14	P05207	1.43e-92	276	155	0.332	0.865	KAP2_PIG cAMP-dependent protein kinase type II-alpha regulatory subunit (Fragment) OS=Sus scrofa OX=9823 GN=PRKAR2A PE=1 SV=1
15	P10644	4.47e-75	240	381	0.359	0.381	KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1
16	P09456	1.27e-74	239	381	0.359	0.381	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
17	P00514	4.09e-74	238	380	0.359	0.382	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
18	P07802	7.23e-74	237	380	0.361	0.384	KAP0_PIG cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Sus scrofa OX=9823 GN=PRKAR1A PE=1 SV=2
19	Q9DBC7	1.25e-73	236	381	0.356	0.378	KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3
20	Q96UX3	2.33e-73	236	413	0.319	0.312	KAPR_ASPFU cAMP-dependent protein kinase regulatory subunit OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pkaR PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	3.6e-37	137.6	Cyclic nucleotide-binding domain
2	PF02197 RIIa	2.3e-13	60.9	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309591	0.998	cAMP-dependent protein kinase catalytic subunit alpha
2	9606.ENSP00000359719	0.998	cAMP-dependent protein kinase catalytic subunit beta
3	9606.ENSP00000366488	0.993	cAMP-dependent protein kinase catalytic subunit gamma
4	9606.ENSP00000265717	0.987	cAMP-dependent protein kinase type II-beta regulatory subunit
5	9606.ENSP00000478212	0.981	A-kinase anchor protein 1, mitochondrial
6	9606.ENSP00000354718	0.978	A-kinase anchor protein 13
7	9606.ENSP00000348573	0.970	A-kinase anchor protein 9
8	9606.ENSP00000351327	0.967	A-kinase anchor protein 4
9	9606.ENSP00000378207	0.967	A-kinase anchor protein 5
10	9606.ENSP00000360485	0.964	A-kinase anchor protein 14
11	9606.ENSP00000225737	0.952	A-kinase anchor protein 10, mitochondrial
12	9606.ENSP00000228850	0.948	A-kinase anchor protein 3
13	9606.ENSP00000269701	0.946	A-kinase anchor protein 8
14	9606.ENSP00000400175	0.943	Transforming protein RhoA
15	9606.ENSP00000360141	0.937	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
16	9606.ENSP00000326031	0.936	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
17	9606.ENSP00000385749	0.932	cAMP-dependent protein kinase type I-beta regulatory subunit
18	9606.ENSP00000215832	0.931	Mitogen-activated protein kinase 1
19	9606.ENSP00000387699	0.930	Cyclic AMP-responsive element-binding protein 1
20	9606.ENSP00000481878	0.927	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.915	enzyme binding
GO:0004862	0.891	cAMP-dependent protein kinase inhibitor activity
GO:0019901	0.842	protein kinase binding
GO:0051018	0.789	protein kinase A binding
GO:0034236	0.725	protein kinase A catalytic subunit binding
GO:0097159	0.421	organic cyclic compound binding
GO:1901363	0.399	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045859	0.995	regulation of protein kinase activity
GO:0009892	0.983	negative regulation of metabolic process
GO:0050896	0.982	response to stimulus
GO:0009987	0.978	cellular process
GO:0006469	0.965	negative regulation of protein kinase activity
GO:0071901	0.956	negative regulation of protein serine/threonine kinase activity
GO:0051716	0.821	cellular response to stimulus
GO:0007165	0.814	signal transduction
GO:0035556	0.646	intracellular signal transduction
GO:0048518	0.574	positive regulation of biological process
GO:0048522	0.453	positive regulation of cellular process
GO:0008152	0.362	metabolic process
GO:0032501	0.341	multicellular organismal process
GO:0071704	0.325	organic substance metabolic process
GO:0044238	0.305	primary metabolic process
GO:0044237	0.305	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0032991	0.996	protein-containing complex
GO:0043229	0.996	intracellular organelle
GO:0005634	0.992	nucleus
GO:1902494	0.988	catalytic complex
GO:0005886	0.970	plasma membrane
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:1990234	0.964	transferase complex
GO:1902554	0.952	serine/threonine protein kinase complex
GO:0120025	0.949	plasma membrane bounded cell projection
GO:0005576	0.934	extracellular region
GO:0005929	0.931	cilium
GO:0140535	0.925	intracellular protein-containing complex
GO:0030054	0.916	cell junction
GO:0005952	0.905	cAMP-dependent protein kinase complex
GO:0005615	0.868	extracellular space
GO:0031982	0.864	vesicle
GO:0070062	0.725	extracellular exosome
GO:0097546	0.618	ciliary base
GO:0005856	0.613	cytoskeleton
GO:0012505	0.397	endomembrane system
GO:0015630	0.318	microtubule cytoskeleton
GO:0005815	0.307	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]