StarFunc result for job id P13928

User Input

>input (327 residues)
MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIA
KSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEIL
ASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLAL
QDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSL
EEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYG
KTLSSMIMEDTSGDYKNALLSLVGSDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13928	1.000	1.000	1.342E-46	327	1.000	1.000	P13928.pdb.gz	ANXA8_HUMAN Annexin A8 OS=Homo sapiens OX=9606 GN=ANXA8 PE=1 SV=3
2	PDB:1w45A	0.939	0.959	3.666E-38	320	0.972	0.994	1w45A.pdb.gz
3	AFDB:P09525	0.951	0.975	1.008E-31	319	0.541	0.555	P09525.pdb.gz	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
4	PDB:2zocA	0.951	0.974	6.404E-31	319	0.541	0.555	2zocA.pdb.gz	The comparison of the loop structure of membrane binding sites between human and bovine annexin IV
5	AFDB:P81287	0.945	0.963	1.635E-30	321	0.547	0.558	P81287.pdb.gz	ANXA5_BOVIN Annexin A5 OS=Bos taurus OX=9913 GN=ANXA5 PE=1 SV=3
6	AFDB:P20072	0.942	0.668	2.304E-30	463	0.492	0.348	P20072.pdb.gz	ANXA7_BOVIN Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2
7	AFDB:B5XEI6	0.938	0.961	4.023E-30	319	0.483	0.495	B5XEI6.pdb.gz	B5XEI6_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA4 PE=2 SV=1
8	AFDB:B5XAE0	0.939	0.968	4.199E-30	317	0.505	0.521	B5XAE0.pdb.gz	B5XAE0_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA5 PE=2 SV=1
9	AFDB:P20073	0.942	0.633	6.729E-30	488	0.486	0.326	P20073.pdb.gz	ANXA7_HUMAN Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 SV=3
10	AFDB:P50995	0.941	0.613	9.083E-30	505	0.517	0.335	P50995.pdb.gz	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
11	PDB:2h0kA	0.930	0.955	1.233E-29	318	0.535	0.550	2h0kA.pdb.gz	Annexin-A5 assembled into two-dimensional arrays promotes cell membrane repair.
12	AFDB:A9JTC0	0.943	0.972	1.336E-29	317	0.526	0.543	A9JTC0.pdb.gz
13	AFDB:Q27512	0.927	0.615	1.883E-29	497	0.446	0.294	Q27512.pdb.gz	Q27512_CAEEL Annexin OS=Caenorhabditis elegans OX=6239 GN=nex-2 PE=1 SV=2
14	PDB:1axnA	0.914	0.925	5.844E-28	323	0.474	0.480	1axnA.pdb.gz	The high-resolution crystal structure of human annexin III shows subtle differences with annexin V.
15	PDB:7p70A	0.950	0.766	3.854E-27	407	0.443	0.356	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:7p73A	0.944	0.738	1.175E-26	420	0.443	0.345	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:1m9iA	0.913	0.457	5.498E-26	664	0.517	0.255	1m9iA.pdb.gz	Structural and Dynamic Changes in Human Annexin VI Induced by a Phosphorylation-Mimicking Mutation, T356D
18	PDB:7pc3A	0.920	0.747	7.422E-26	405	0.440	0.356	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:5n7dA	0.949	0.737	7.747E-26	423	0.443	0.343	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:1avcA	0.915	0.473	8.810E-26	642	0.517	0.263	1avcA.pdb.gz	Crystal structure of bovine annexin VI in a calcium-bound state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13928	0.0	677	327	1.000	1.000	ANXA8_HUMAN Annexin A8 OS=Homo sapiens OX=9606 GN=ANXA8 PE=1 SV=3
2	P09525	4.63e-123	357	319	0.541	0.555	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
3	P13214	8.44e-123	357	319	0.547	0.561	ANXA4_BOVIN Annexin A4 OS=Bos taurus OX=9913 GN=ANXA4 PE=1 SV=2
4	P97429	4.45e-119	347	319	0.538	0.552	ANXA4_MOUSE Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4
5	P81287	6.66e-114	334	321	0.544	0.555	ANXA5_BOVIN Annexin A5 OS=Bos taurus OX=9913 GN=ANXA5 PE=1 SV=3
6	P14668	8.73e-114	334	319	0.547	0.561	ANXA5_RAT Annexin A5 OS=Rattus norvegicus OX=10116 GN=Anxa5 PE=1 SV=3
7	P08758	6.09e-113	332	320	0.538	0.550	ANXA5_HUMAN Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2
8	Q803A1	2.04e-112	330	317	0.526	0.543	Q803A1_DANRE Annexin OS=Danio rerio OX=7955 GN=ANX V PE=1 SV=1
9	P48036	7.71e-111	327	319	0.529	0.542	ANXA5_MOUSE Annexin A5 OS=Mus musculus OX=10090 GN=Anxa5 PE=1 SV=1
10	B5XAE0	1.63e-110	325	317	0.505	0.521	B5XAE0_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA5 PE=2 SV=1
11	C0H815	3.01e-110	325	317	0.505	0.521	C0H815_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA5 PE=2 SV=1
12	P33477	6.70e-110	330	503	0.520	0.338	ANX11_RABIT Annexin A11 OS=Oryctolagus cuniculus OX=9986 GN=ANXA11 PE=1 SV=1
13	P50995	2.64e-109	329	505	0.517	0.335	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
14	Q5T0G8	2.64e-109	329	505	0.517	0.335	Q5T0G8_HUMAN Annexin OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
15	P97384	1.30e-108	327	503	0.511	0.332	ANX11_MOUSE Annexin A11 OS=Mus musculus OX=10090 GN=Anxa11 PE=1 SV=2
16	A8KBY8	9.93e-108	330	667	0.529	0.259	A8KBY8_DANRE Annexin OS=Danio rerio OX=7955 GN=anx6 PE=1 SV=1
17	P17153	1.39e-106	316	321	0.508	0.517	ANXA5_CHICK Annexin A5 OS=Gallus gallus OX=9031 GN=ANXA5 PE=1 SV=2
18	B5XEI6	1.60e-106	315	319	0.483	0.495	B5XEI6_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA4 PE=2 SV=1
19	P20072	4.67e-105	317	463	0.492	0.348	ANXA7_BOVIN Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2
20	Q6IRJ7	4.67e-105	317	463	0.489	0.346	Q6IRJ7_RAT Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00191 Annexin	4.1e-94	320.0	Annexin
2	PF12006 DUF3500	58	14.7	Protein of unknown function (DUF3500)
3	PF19668 DUF6171	1.6e+02	14.0	Family of unknown function (DUF6171)
4	PF17910 FeoB_Cyto	97	14.9	FeoB cytosolic helical domain
5	PF11987 IF-2	4.4	18.7	Translation-initiation factor 2
6	PF15963 Myb_DNA-bind_7	1.1	20.4	Myb DNA-binding like
7	PF04546 Sigma70_ner	1.6e+02	13.7	Sigma-70, non-essential region
8	PF04820 Trp_halogenase	3.8e+02	11.3	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480221

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386881	0.821	Dysferlin
2	9606.ENSP00000251968	0.710	Tumor susceptibility gene 101 protein
3	9606.ENSP00000447730	0.691	CD63 antigen
4	9606.ENSP00000371958	0.689	CD9 antigen
5	9606.ENSP00000263645	0.687	CD81 antigen
6	9606.ENSP00000227155	0.653	CD82 antigen
7	9606.ENSP00000271638	0.593	Protein S100-A11
8	9606.ENSP00000312675	0.564	Tripartite motif-containing protein 72
9	9606.ENSP00000302961	0.561	Heat shock protein family A member 4
10	9606.ENSP00000417050	0.556	Tetraspanin
11	9606.ENSP00000335153	0.538	Heat shock protein HSP 90-alpha
12	9606.ENSP00000367263	0.515	Neuroblast differentiation-associated protein AHNAK
13	9606.ENSP00000411825	0.504	Programmed cell death 6-interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005544	0.995	calcium-dependent phospholipid binding
GO:0043168	0.969	anion binding
GO:0035091	0.946	phosphatidylinositol binding
GO:0044877	0.920	protein-containing complex binding
GO:0005509	0.907	calcium ion binding
GO:1901363	0.831	heterocyclic compound binding
GO:0097159	0.825	organic cyclic compound binding
GO:0003676	0.810	nucleic acid binding
GO:1902936	0.582	phosphatidylinositol bisphosphate binding
GO:0005546	0.568	phosphatidylinositol-4,5-bisphosphate binding
GO:0008092	0.513	cytoskeletal protein binding
GO:0003779	0.489	actin binding
GO:0051015	0.480	actin filament binding
GO:0042802	0.369	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.861	regulation of cellular process
GO:0071840	0.859	cellular component organization or biogenesis
GO:0016043	0.850	cellular component organization
GO:0019222	0.845	regulation of metabolic process
GO:0050790	0.779	regulation of catalytic activity
GO:0010256	0.749	endomembrane system organization
GO:0048519	0.733	negative regulation of biological process
GO:0060255	0.725	regulation of macromolecule metabolic process
GO:0050896	0.724	response to stimulus
GO:0051179	0.663	localization
GO:0051171	0.656	regulation of nitrogen compound metabolic process
GO:0080090	0.653	regulation of primary metabolic process
GO:0043086	0.643	negative regulation of catalytic activity
GO:0051346	0.634	negative regulation of hydrolase activity
GO:0051246	0.536	regulation of protein metabolic process
GO:0051641	0.464	cellular localization
GO:0006810	0.445	transport
GO:0006996	0.436	organelle organization
GO:0048518	0.379	positive regulation of biological process
GO:0048522	0.337	positive regulation of cellular process
GO:0031323	0.319	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0031982	1.000	vesicle
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0031410	0.994	cytoplasmic vesicle
GO:0005886	0.993	plasma membrane
GO:0005829	0.985	cytosol
GO:0012506	0.963	vesicle membrane
GO:0005768	0.954	endosome
GO:0005615	0.925	extracellular space
GO:0030312	0.905	external encapsulating structure
GO:0070062	0.895	extracellular exosome
GO:0031012	0.884	extracellular matrix
GO:0030659	0.850	cytoplasmic vesicle membrane
GO:0098588	0.743	bounding membrane of organelle
GO:0062023	0.702	collagen-containing extracellular matrix
GO:0005634	0.563	nucleus
GO:0099503	0.517	secretory vesicle
GO:0030141	0.449	secretory granule
GO:0005770	0.431	late endosome
GO:0031902	0.337	late endosome membrane
GO:0030054	0.316	cell junction
GO:0032991	0.310	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]