StarFunc result for job id P13942

User Input

>input (1736 residues)
MERCSRCHRLLLLLPLVLGLSAAPGWAGAPPVDVLRALRFPSLPDGVRRAKGICPADVAY
RVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPV
RFLYEDQTGRPQPPSQPVFRGLSLADGKWHRVAVAVKGQSVTLIVDCKKRVTRPLPRSAR
PVLDTHGVIIFGARILDEEVFEGDVQELAIVPGVQAAYESCEQKELECEGGQRERPQNQQ
PHRAQRSPQQQPSRLHRPQNQEPQSQPTESLYYDYEPPYYDVMTTGTTPDYQDPTPGEEE
EILESSLLPPLEEEQTDLQVPPTADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETEL
GPALSAETAHSGAAAHGPRGLKGEKGEPAVLEPGMLVEGPPGPEGPAGLIGPPGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSGGGDKGPVVAAQEAQAQAILQQ
ARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRA
GADGARGMPGDPGVKGDRGFDGLPGLPGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPR
GLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPQGPKGSLGPQGEPGPPGQQGTPGTQGLP
GPQGAIGPHGEKGPQGKPGLPGMPGSDGPPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPR
GVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPT
GDPGPPGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGER
GPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPLGPPGKD
GLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGAAGETGPMGERGHPGPPGPPGEQGLPGTA
GKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGLKGNEGPSGPPGPAGSPGER
GAAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVA
GEDGDKGEVGDPGQKGTKGNKGEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAK
GDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPP
GGVGNLGPPGEKGEPGESGSPGIQGEPGVKGPRGERGEKGESGQPGEPGPPGPKGPTGDD
GPKGNPGPVGFPGDPGPPGEGGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKR
GPAGSPGSEGRQGGKGAKGDPGAIGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGRP
GATGQAGPPGPVGPPGLPGLRGDAGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSP
GQKGEMGIPGASGPIGPGGPPGLPGPAGPKGAKGATGPGGPKGEKGVQGPPGHPGPPGEV
IQPLPIQMPKKTRRSVDGSRLMQEDEAIPTGGAPGSPGGLEEIFGSLDSLREEIEQMRRP
TGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVT
QFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSGAARDGPLRLRGANEDELSPETSP
YVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSDLGAPPRRGGVLLGPVCFMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F6T0B3	0.273	0.285	0.000	1650	0.904	0.951	F6T0B3.pdb.gz	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
2	AFDB:I3ISS1	0.242	0.234	0.000	1803	0.718	0.692	I3ISS1.pdb.gz
3	AFDB:P12107	0.221	0.214	0.000	1806	0.672	0.646	P12107.pdb.gz	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
4	AFDB:Q9JI03	0.164	0.156	0.000	1840	0.688	0.649	Q9JI03.pdb.gz	CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus OX=10116 GN=Col5a1 PE=1 SV=1
5	AFDB:P25940	0.214	0.213	9.747E-84	1745	0.552	0.549	P25940.pdb.gz	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
6	AFDB:Q9JLI2	0.219	0.219	1.044E-82	1739	0.547	0.546	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
7	AFDB:A0A0G2K069	0.145	0.382	3.614E-72	624	0.329	0.915	A0A0G2K069.pdb.gz	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
8	AFDB:C7DZK3	0.113	0.110	1.841E-41	1783	0.377	0.367	C7DZK3.pdb.gz	CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio OX=7955 GN=col27a1a PE=2 SV=1
9	AFDB:Q8IZC6	0.124	0.116	4.969E-41	1860	0.370	0.345	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
10	AFDB:A0MSJ1	0.133	0.139	6.547E-41	1658	0.342	0.358	A0MSJ1.pdb.gz	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
11	PDB:7ufgA	0.075	0.109	6.794E-6	1151	0.017	0.026	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
12	PDB:7ufgB	0.081	0.117	8.017E-6	1182	0.018	0.027	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:7zl1A	0.073	0.524	1.554E-5	215	0.014	0.116	7zl1A.pdb.gz
14	PDB:8a7eC	0.074	0.084	2.047E-5	1524	0.016	0.018	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
15	PDB:3v0aB	0.085	0.127	2.553E-5	1150	0.012	0.018	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
16	PDB:7qfqA	0.078	0.102	7.280E-5	1291	0.012	0.015	7qfqA.pdb.gz
17	PDB:4pbpB	0.072	0.534	8.589E-5	210	0.015	0.124	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
18	PDB:6l6aA	0.063	0.520	1.013E-4	142	0.010	0.120	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
19	PDB:3ffzA	0.071	0.097	2.194E-4	1246	0.012	0.016	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
20	PDB:5dg2B	0.061	0.547	2.735E-4	131	0.010	0.130	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K069	2295	1736	0.950	0.950	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
2	A0A8I5ZM36	2254	1715	0.940	0.952	A0A8I5ZM36_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
3	A0A8I5ZR92	2145	1676	0.916	0.949	A0A8I5ZR92_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
4	A0A8I5ZY93	2278	1710	0.936	0.950	A0A8I5ZY93_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
5	A0A8I6A1U6	1694	1655	0.763	0.800	A0A8I6A1U6_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
6	A0A8I6AUU9	2174	1689	0.917	0.943	A0A8I6AUU9_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
7	F1R5X4	1467	1721	0.717	0.723	F1R5X4_DANRE Collagen alpha-2(XI) chain isoform X6 OS=Danio rerio OX=7955 GN=col11a1 PE=1 SV=2
8	F6T0B3	2346	1629	0.762	0.812	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
9	F7EVZ0	991	1736	0.561	0.561	F7EVZ0_RAT Collagen type V alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col5a3 PE=4 SV=1
10	O88207	1002	1838	0.603	0.569	CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus OX=10090 GN=Col5a1 PE=1 SV=2
11	P12107	1313	1806	0.676	0.650	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
12	P13942	3175	1736	1.000	1.000	COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens OX=9606 GN=COL11A2 PE=1 SV=5
13	P20908	1239	1838	0.693	0.655	CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens OX=9606 GN=COL5A1 PE=1 SV=3
14	P20909	1342	1804	0.674	0.649	COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus OX=10116 GN=Col11a1 PE=1 SV=2
15	P25940	992	1745	0.556	0.554	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
16	Q28083	584	911	0.362	0.690	COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus OX=9913 GN=COL11A1 PE=1 SV=1
17	Q32S24	2313	1736	0.953	0.953	COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus OX=9913 GN=COL11A2 PE=3 SV=1
18	Q61245	1371	1804	0.674	0.649	COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus OX=10090 GN=Col11a1 PE=1 SV=2
19	Q64739	2337	1736	0.945	0.945	COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus OX=10090 GN=Col11a2 PE=2 SV=3
20	Q6MGB2	2739	1617	0.885	0.951	Q6MGB2_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	4.1e-54	194.9	Fibrillar collagen C-terminal domain
2	PF01391 Collagen	7e-159	527.1	Collagen triple helix repeat (20 copies)
3	PF00054 Laminin_G_1	19	16.9	Laminin G domain
4	PF02210 Laminin_G_2	0.00062	31.8	Laminin G domain
5	PF13385 Laminin_G_3	0.73	21.4	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003808635.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008953328.1	0.797	Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion.
2	9597.XP_003812920.1	0.730	Prolyl 3-hydroxylase 1
3	9597.XP_003821876.1	0.726	Collagen type IV alpha 4 chain
4	9597.XP_008971349.1	0.723	Collagen alpha-6(IV) chain isoform X1
5	9597.XP_008959997.1	0.721	Belongs to the integrin beta chain family.
6	9597.XP_008965875.1	0.721	Belongs to the integrin beta chain family.
7	9597.XP_003823651.1	0.706	Bone morphogenetic protein 1
8	9597.XP_003818412.1	0.700	ADAM metallopeptidase with thrombospondin type 1 motif 3
9	9597.XP_008949371.1	0.698	Collagen alpha-1(II) chain
10	9597.XP_008967208.1	0.695	ADAM metallopeptidase with thrombospondin type 1 motif 14
11	9597.XP_003823854.1	0.688	Collagen alpha-1(VI) chain
12	9597.XP_003812960.1	0.684	Procollagen C-endopeptidase enhancer
13	9597.XP_003814752.1	0.684	Belongs to the serpin family.
14	9597.XP_003809906.1	0.678	A disintegrin and metalloproteinase with thrombospondin motifs 2
15	9597.XP_003825461.1	0.676	Tolloid-like protein 2
16	9597.XP_003821841.1	0.675	Tolloid-like protein 1 isoform X1
17	9597.XP_003815656.2	0.674	Collagen beta(1-O)galactosyltransferase 2
18	9597.XP_003827399.1	0.667	Belongs to the integrin alpha chain family.
19	9597.XP_003813155.1	0.666	Collagen type VI alpha 3 chain
20	9597.XP_003826560.1	0.662	Procollagen C-endopeptidase enhancer 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	0.999	extracellular matrix structural constituent conferring tensile strength
GO:0097367	0.891	carbohydrate derivative binding
GO:1901681	0.873	sulfur compound binding
GO:0008201	0.845	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0032501	0.986	multicellular organismal process
GO:0032502	0.973	developmental process
GO:0048869	0.735	cellular developmental process
GO:0030154	0.706	cell differentiation
GO:0001503	0.592	ossification
GO:0001649	0.568	osteoblast differentiation
GO:0048856	0.424	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0005576	0.997	extracellular region
GO:0070013	0.993	intracellular organelle lumen
GO:0012505	0.992	endomembrane system
GO:0032991	0.990	protein-containing complex
GO:0005581	0.984	collagen trimer
GO:0043227	0.978	membrane-bounded organelle
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005737	0.945	cytoplasm
GO:0005788	0.863	endoplasmic reticulum lumen
GO:0005615	0.652	extracellular space
GO:0098644	0.587	complex of collagen trimers
GO:0099081	0.571	supramolecular polymer
GO:0099512	0.559	supramolecular fiber
GO:0005583	0.509	fibrillar collagen trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]