StarFunc result for job id P13984

User Input

>input (249 residues)
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDU9	0.577	0.577	1.527E-44	249	1.000	1.000	A0A024RDU9.pdb.gz
2	PDB:6o9lT	0.517	0.539	7.384E-36	237	0.948	0.996	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
3	AFDB:P41900	0.519	0.468	4.384E-28	277	0.510	0.458	P41900.pdb.gz	T2FB_DROME General transcription factor IIF subunit 2 OS=Drosophila melanogaster OX=7227 GN=TfIIFbeta PE=2 SV=2
4	PDB:7edxT	0.401	0.852	3.941E-17	113	0.450	0.991	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:Q9LQZ4	0.487	0.466	5.333E-17	261	0.237	0.226	Q9LQZ4.pdb.gz	Q9LQZ4_ARATH At1g75700 OS=Arabidopsis thaliana OX=3702 GN=At1g75510 PE=1 SV=1
6	AFDB:O94424	0.410	0.341	6.386E-17	307	0.277	0.225	O94424.pdb.gz	T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfg2 PE=1 SV=1
7	PDB:7o4iR	0.429	0.404	1.992E-13	268	0.265	0.246	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
8	PDB:5svag	0.393	0.557	5.873E-13	172	0.189	0.273	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
9	AFDB:P41896	0.374	0.244	1.842E-12	400	0.273	0.170	P41896.pdb.gz	T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFG2 PE=1 SV=2
10	PDB:5fywR	0.353	0.425	9.879E-12	199	0.221	0.276	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
11	AFDB:Q9P7X2	0.302	0.151	1.567E-7	533	0.173	0.081	Q9P7X2.pdb.gz	ELL1_SCHPO RNA polymerase II elongation factor ell1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ell1 PE=1 SV=1
12	AFDB:A0A2R8RXT0	0.313	0.141	2.533E-7	660	0.185	0.070	A0A2R8RXT0.pdb.gz
13	AFDB:O00472	0.304	0.133	4.349E-7	640	0.169	0.066	O00472.pdb.gz	ELL2_HUMAN RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2
14	AFDB:O08856	0.286	0.137	2.636E-6	602	0.124	0.051	O08856.pdb.gz	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
15	AFDB:P55199	0.326	0.165	8.760E-6	621	0.129	0.052	P55199.pdb.gz	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
16	PDB:7ae1M	0.212	0.146	4.424E-5	400	0.116	0.072	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
17	PDB:7okxM	0.350	0.558	4.988E-5	139	0.100	0.180	7okxM.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
18	PDB:7eghA	0.207	0.086	5.511E-4	630	0.096	0.038	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
19	PDB:7egbA	0.209	0.097	6.599E-4	558	0.096	0.043	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:5iy6S	0.219	0.363	1.203E-3	138	0.064	0.116	5iy6S.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13984	0.0	515	249	1.000	1.000	T2FB_HUMAN General transcription factor IIF subunit 2 OS=Homo sapiens OX=9606 GN=GTF2F2 PE=1 SV=2
2	Q01750	0.0	501	249	0.972	0.972	T2FB_RAT General transcription factor IIF subunit 2 OS=Rattus norvegicus OX=10116 GN=Gtf2f2 PE=1 SV=1
3	P41900	9.25e-73	225	277	0.494	0.444	T2FB_DROME General transcription factor IIF subunit 2 OS=Drosophila melanogaster OX=7227 GN=TfIIFbeta PE=2 SV=2
4	O94424	5.79e-19	86.3	307	0.273	0.221	T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfg2 PE=1 SV=1
5	Q9LQZ4	2.58e-11	63.9	261	0.285	0.272	Q9LQZ4_ARATH At1g75700 OS=Arabidopsis thaliana OX=3702 GN=At1g75510 PE=1 SV=1
6	P41896	2.23e-08	56.2	400	0.173	0.107	T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFG2 PE=1 SV=2
7	P11205	1.0	33.1	2204	0.092	0.010	L_NDVB RNA-directed RNA polymerase L OS=Newcastle disease virus (strain Beaudette C/45) OX=11178 GN=L PE=3 SV=1
8	Q9BQT8	5.8	30.4	299	0.056	0.047	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
9	P16043	9.9	28.5	103	0.072	0.175	SLIB_MOUSE Somatoliberin OS=Mus musculus OX=10090 GN=Ghrh PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01655 Ribosomal_L32e	1.1e+02	14.6	Ribosomal protein L32
2	PF00448 SRP54	2.1e+02	13.0	SRP54-type protein, GTPase domain
3	PF02270 TFIIF_beta	5.1e-23	92.3	TFIIF, beta subunit HTH domain
4	PF17683 TFIIF_beta_N	1.6e-14	66.2	TFIIF, beta subunit N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301788	0.999	DNA-directed RNA polymerase II subunit RPB7
2	9606.ENSP00000359531	0.999	Transcription initiation factor IIB
3	9606.ENSP00000370625	0.999	DNA-directed RNA polymerase II subunit RPB2
4	9606.ENSP00000377969	0.999	General transcription factor IIF subunit 1
5	9606.ENSP00000478303	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
6	9606.ENSP00000480158	0.999	DNA-directed RNA polymerase II subunit RPB1
7	9606.ENSP00000219252	0.998	DNA-directed RNA polymerase II subunit RPB3
8	9606.ENSP00000221859	0.998	DNA-directed RNA polymerase II subunit RPB9
9	9606.ENSP00000283875	0.998	General transcription factor IIE subunit 1
10	9606.ENSP00000348168	0.998	Transcription initiation factor IIE subunit beta
11	9606.ENSP00000375942	0.996	TATA-box-binding protein
12	9606.ENSP00000484525	0.996	RNA polymerase II subunit A C-terminal domain phosphatase
13	9606.ENSP00000285398	0.995	TFIIH basal transcription factor complex helicase XPB subunit
14	9606.ENSP00000292614	0.994	DNA-directed RNA polymerase II subunit RPB11-a
15	9606.ENSP00000272645	0.992	DNA-directed RNA polymerase II subunit RPB4
16	9606.ENSP00000342889	0.992	DNA-directed RNA polymerases I, II, and III subunit RPABC4
17	9606.ENSP00000403852	0.990	DNA-directed RNA polymerases I, II, and III subunit RPABC2
18	9606.ENSP00000261245	0.986	CDK-activating kinase assembly factor MAT1
19	9606.ENSP00000324124	0.986	DNA-directed RNA polymerases I, II, and III subunit RPABC5
20	9606.ENSP00000428426	0.986	Transcription elongation factor A protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.806	heterocyclic compound binding
GO:0097159	0.806	organic cyclic compound binding
GO:0140223	0.803	general transcription initiation factor activity
GO:0003676	0.676	nucleic acid binding
GO:0016251	0.329	RNA polymerase II general transcription initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0010467	0.988	gene expression
GO:0016070	0.986	RNA metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.955	regulation of nitrogen compound metabolic process
GO:0009059	0.946	macromolecule biosynthetic process
GO:0044271	0.946	cellular nitrogen compound biosynthetic process
GO:0050794	0.932	regulation of cellular process
GO:0009889	0.928	regulation of biosynthetic process
GO:0006366	0.914	transcription by RNA polymerase II
GO:0031323	0.905	regulation of cellular metabolic process
GO:0006367	0.887	transcription initiation at RNA polymerase II promoter
GO:0019219	0.882	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.872	regulation of macromolecule biosynthetic process
GO:0031326	0.868	regulation of cellular biosynthetic process
GO:0010468	0.863	regulation of gene expression
GO:0051252	0.847	regulation of RNA metabolic process
GO:0006368	0.821	transcription elongation by RNA polymerase II
GO:2001141	0.739	regulation of RNA biosynthetic process
GO:0006355	0.708	regulation of DNA-templated transcription
GO:0048518	0.619	positive regulation of biological process
GO:0010604	0.588	positive regulation of macromolecule metabolic process
GO:0048522	0.575	positive regulation of cellular process
GO:0045935	0.531	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.519	positive regulation of DNA-templated transcription
GO:0006357	0.508	regulation of transcription by RNA polymerase II
GO:0045944	0.387	positive regulation of transcription by RNA polymerase II
GO:0071840	0.328	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0140513	0.999	nuclear protein-containing complex
GO:1902494	0.996	catalytic complex
GO:1990234	0.994	transferase complex
GO:0090575	0.990	RNA polymerase II transcription regulator complex
GO:0016591	0.975	RNA polymerase II, holoenzyme
GO:0015630	0.911	microtubule cytoskeleton
GO:0005737	0.725	cytoplasm
GO:0016020	0.333	membrane
GO:0005829	0.333	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]