StarFunc result for job id P13995

User Input

>input (350 residues)
MAATSLMSALAARLLQPAHSCSLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEW
VASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKL
NNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGV
WEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQL
KKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQ
KAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13995	1.000	1.000	4.655E-70	350	1.000	1.000	P13995.pdb.gz	MTDC_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2
2	AFDB:Q9H903	0.858	0.866	2.278E-55	347	0.646	0.651	Q9H903.pdb.gz	MTD2L_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2L PE=1 SV=3
3	PDB:6s4fB	0.848	0.996	1.790E-54	298	0.851	1.000	6s4fB.pdb.gz	Pharmacological targeting of MTHFD2 suppresses acute myeloid leukemia by inducing thymidine depletion and replication stress.
4	AFDB:D3ZUA0	0.857	0.887	8.808E-54	338	0.634	0.657	D3ZUA0.pdb.gz	MTD2L_RAT Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mthfd2l PE=1 SV=1
5	AFDB:P54382	0.784	0.966	5.018E-37	283	0.409	0.505	P54382.pdb.gz	FOLD_BACSU Bifunctional protein FolD OS=Bacillus subtilis (strain 168) OX=224308 GN=folD PE=1 SV=1
6	AFDB:P09440	0.805	0.304	1.697E-36	975	0.414	0.149	P09440.pdb.gz	C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIS1 PE=1 SV=1
7	AFDB:Q9LHH7	0.794	0.926	6.563E-35	299	0.383	0.448	Q9LHH7.pdb.gz	FOLD2_ARATH Bifunctional protein FolD 2 OS=Arabidopsis thaliana OX=3702 GN=FOLD2 PE=2 SV=1
8	AFDB:O65271	0.775	0.754	9.850E-35	360	0.400	0.389	O65271.pdb.gz	FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLD4 PE=1 SV=1
9	AFDB:P24186	0.773	0.936	1.567E-34	288	0.394	0.479	P24186.pdb.gz	FOLD_ECOLI Bifunctional protein FolD OS=Escherichia coli (strain K12) OX=83333 GN=folD PE=1 SV=4
10	AFDB:O43007	0.794	0.291	6.306E-34	972	0.369	0.133	O43007.pdb.gz	C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade9 PE=3 SV=3
11	AFDB:O96553	0.795	0.293	3.809E-33	968	0.394	0.143	O96553.pdb.gz	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
12	PDB:4cjxA	0.780	0.914	4.241E-32	297	0.354	0.418	4cjxA.pdb.gz	Characterization of 2,4-Diamino-6-Oxo-1,6-Dihydropyrimidin-5-Yl Ureido Based Inhibitors of Trypanosoma Brucei Fold and Testing for Antiparasitic Activity.
13	PDB:1b0aA	0.759	0.920	1.434E-31	287	0.394	0.481	1b0aA.pdb.gz
14	PDB:4a26A	0.769	0.903	7.413E-30	296	0.366	0.432	4a26A.pdb.gz
15	PDB:2c2xA	0.755	0.937	1.050E-29	280	0.340	0.425	2c2xA.pdb.gz
16	PDB:1ee9A	0.677	0.743	1.848E-17	317	0.209	0.230	1ee9A.pdb.gz	The X-ray structure of the NAD-dependent 5,10-methylenetetrahydrofolate dehydrogenase from Saccharomyces cerevisiae.
17	PDB:1npdB	0.463	0.546	8.913E-7	288	0.120	0.146	1npdB.pdb.gz	The 2.3-A crystal structure of the shikimate 5-dehydrogenase orthologue YdiB from Escherichia coli suggests a novel catalytic environment for an NAD-dependent dehydrogenase
18	PDB:1a7aA	0.252	0.221	8.082E-6	431	0.151	0.123	1a7aA.pdb.gz	Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
19	PDB:2gcgA	0.214	0.226	1.621E-5	324	0.123	0.133	2gcgA.pdb.gz	Structural basis of substrate specificity in human glyoxylate reductase/hydroxypyruvate reductase
20	PDB:3jtmA	0.238	0.238	2.296E-5	351	0.129	0.128	3jtmA.pdb.gz	Structure of recombinant formate dehydrogenase from Arabidopsis thaliana

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2R7W0	0.0	700	344	0.983	1.000	B2R7W0_HUMAN methenyltetrahydrofolate cyclohydrolase OS=Homo sapiens OX=9606 PE=1 SV=1
2	P13995	0.0	712	350	1.000	1.000	MTDC_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2
3	P18155	0.0	659	350	0.920	0.920	MTDC_MOUSE Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Mthfd2 PE=1 SV=1
4	Q9H903	1.05e-169	478	347	0.631	0.637	MTD2L_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2L PE=1 SV=3
5	D3ZUA0	8.75e-164	462	338	0.614	0.636	MTD2L_RAT Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mthfd2l PE=1 SV=1
6	P54382	1.58e-89	272	283	0.406	0.502	FOLD_BACSU Bifunctional protein FolD OS=Bacillus subtilis (strain 168) OX=224308 GN=folD PE=1 SV=1
7	P24186	2.43e-82	253	288	0.397	0.483	FOLD_ECOLI Bifunctional protein FolD OS=Escherichia coli (strain K12) OX=83333 GN=folD PE=1 SV=4
8	Q9LHH7	3.21e-76	238	299	0.383	0.448	FOLD2_ARATH Bifunctional protein FolD 2 OS=Arabidopsis thaliana OX=3702 GN=FOLD2 PE=2 SV=1
9	O65271	8.69e-76	239	360	0.397	0.386	FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLD4 PE=1 SV=1
10	P09440	8.30e-71	239	975	0.394	0.142	C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIS1 PE=1 SV=1
11	Q57WP0	4.23e-66	212	298	0.357	0.419	Q57WP0_TRYB2 C-1-tetrahydrofolate synthase, cytoplasmic, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.970 PE=1 SV=1
12	O96553	7.59e-65	223	968	0.386	0.139	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
13	Q4Q9F9	7.69e-63	204	298	0.366	0.430	Q4Q9F9_LEIMA methenyltetrahydrofolate cyclohydrolase OS=Leishmania major OX=5664 GN=LMJF_26_0320 PE=1 SV=1
14	O43007	6.08e-62	215	972	0.377	0.136	C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade9 PE=3 SV=3
15	P9WG81	1.49e-59	195	281	0.343	0.427	FOLD_MYCTU Bifunctional protein FolD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=folD PE=1 SV=1
16	Q8WZJ7	3.17e-58	204	937	0.351	0.131	C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC839.16 PE=3 SV=1
17	Q6FND0	1.18e-57	202	946	0.369	0.136	Q6FND0_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00913g PE=3 SV=1
18	V9GYY3	1.67e-55	196	922	0.340	0.129	V9GYY3_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2
19	P11586	1.95e-55	196	935	0.340	0.127	C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=4
20	F5H2F4	3.04e-55	196	964	0.340	0.123	F5H2F4_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	53	14.6	Alanine dehydrogenase/PNT, C-terminal domain
2	PF00763 THF_DHG_CYH	5.9e-37	137.7	Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
3	PF02882 THF_DHG_CYH_C	4.4e-59	209.9	Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377617

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371253	0.995	Trifunctional purine biosynthetic protein adenosine-3
2	9606.ENSP00000333667	0.993	Serine hydroxymethyltransferase, mitochondrial
3	9606.ENSP00000318868	0.991	Serine hydroxymethyltransferase, cytosolic
4	9606.ENSP00000236959	0.986	Bifunctional purine biosynthesis protein PURH
5	9606.ENSP00000273588	0.980	Aminomethyltransferase, mitochondrial
6	9606.ENSP00000365777	0.977	Methylenetetrahydrofolate reductase
7	9606.ENSP00000315644	0.973	Thymidylate synthase
8	9606.ENSP00000258874	0.963	5-formyltetrahydrofolate cyclo-ligase
9	9606.ENSP00000258494	0.962	Mitochondrial 10-formyltetrahydrofolate dehydrogenase
10	9606.ENSP00000220058	0.961	Methionyl-tRNA formyltransferase, mitochondrial
11	9606.ENSP00000379108	0.961	Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
12	9606.ENSP00000478253	0.956	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
13	9606.ENSP00000455643	0.950	5-formyltetrahydrofolate cyclo-ligase
14	9606.ENSP00000291670	0.947	Formimidoyltransferase-cyclodeaminase
15	9606.ENSP00000273450	0.941	Cytosolic 10-formyltetrahydrofolate dehydrogenase
16	9606.ENSP00000216605	0.937	C-1-tetrahydrofolate synthase, cytoplasmic
17	9606.ENSP00000360268	0.799	Delta-1-pyrroline-5-carboxylate synthase
18	9606.ENSP00000365773	0.785	Phosphoserine aminotransferase
19	9606.ENSP00000370737	0.779	Glycine dehydrogenase (decarboxylating), mitochondrial
20	9606.ENSP00000264220	0.755	Amidophosphoribosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004486	0.999	methylenetetrahydrofolate dehydrogenase [NAD(P)+] activity
GO:0004477	0.999	methenyltetrahydrofolate cyclohydrolase activity
GO:0004488	0.987	methylenetetrahydrofolate dehydrogenase (NADP+) activity
GO:0004487	0.938	methylenetetrahydrofolate dehydrogenase (NAD+) activity
GO:0043167	0.543	ion binding
GO:0043168	0.475	anion binding
GO:0000287	0.438	magnesium ion binding
GO:0042301	0.341	phosphate ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046483	0.998	heterocycle metabolic process
GO:1901360	0.997	organic cyclic compound metabolic process
GO:0006725	0.997	cellular aromatic compound metabolic process
GO:0043648	0.990	dicarboxylic acid metabolic process
GO:0046653	0.988	tetrahydrofolate metabolic process
GO:0006767	0.939	water-soluble vitamin metabolic process
GO:0043603	0.899	amide metabolic process
GO:0044238	0.397	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005576	0.933	extracellular region
GO:0005615	0.910	extracellular space
GO:0005759	0.705	mitochondrial matrix
GO:0005829	0.327	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.1.5	0.999	methylenetetrahydrofolate dehydrogenase (NADP(+)).
RHEA:23700	0.999	(6R)-5,10-methenyltetrahydrofolate + H2O = (6R)-10-formyltetrahydrofolate + H(+)
EC:3.5.4.9	0.999	methenyltetrahydrofolate cyclohydrolase.
RHEA:22812	0.987	(6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + NADP(+) = (6R)-5,10-methenyltetrahydrofolate + NADPH
RHEA:22892	0.938	(6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + NAD(+) = (6R)-5,10-methenyltetrahydrofolate + NADH
EC:1.5.1.15	0.938	methylenetetrahydrofolate dehydrogenase (NAD(+)).

[back to server]