StarFunc result for job id P14091

User Input

>input (396 residues)
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAE
FDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSH
FSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNA
IGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDI
HPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14091	1.000	1.000	9.624E-88	396	1.000	1.000	P14091.pdb.gz	CATE_HUMAN Cathepsin E OS=Homo sapiens OX=9606 GN=CTSE PE=1 SV=3
2	AFDB:P16228	0.970	0.966	3.080E-74	398	0.831	0.827	P16228.pdb.gz	CATE_RAT Cathepsin E OS=Rattus norvegicus OX=10116 GN=Ctse PE=1 SV=3
3	AFDB:Q805F3	0.922	0.920	2.805E-63	397	0.667	0.665	Q805F3.pdb.gz	CATEA_XENLA Cathepsin E-A OS=Xenopus laevis OX=8355 GN=ctse-a PE=1 SV=1
4	PDB:1tzsA	0.792	0.972	1.504E-58	322	0.811	0.997	1tzsA.pdb.gz	Crystal structure of an activation intermediate of cathepsin e
5	AFDB:Q05744	0.878	0.873	9.890E-53	398	0.439	0.437	Q05744.pdb.gz	CATD_CHICK Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 SV=1
6	AFDB:O93428	0.897	0.897	1.462E-52	396	0.457	0.457	O93428.pdb.gz	CATD_CHIHA Cathepsin D OS=Chionodraco hamatus OX=36188 GN=ctsd PE=1 SV=2
7	AFDB:P0DJD7	0.872	0.890	1.462E-52	388	0.508	0.518	P0DJD7.pdb.gz	PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens OX=9606 GN=PGA4 PE=1 SV=1
8	AFDB:Q7K485	0.900	0.909	1.635E-52	392	0.427	0.431	Q7K485.pdb.gz	Q7K485_DROME Cathepsin D OS=Drosophila melanogaster OX=7227 GN=cathD PE=1 SV=1
9	AFDB:Q9GK11	0.861	0.894	7.804E-52	381	0.505	0.525	Q9GK11.pdb.gz	CHYM_CAMDR Chymosin OS=Camelus dromedarius OX=9838 GN=CYM PE=1 SV=1
10	AFDB:P20142	0.883	0.901	1.612E-51	388	0.447	0.456	P20142.pdb.gz	PEPC_HUMAN Gastricsin OS=Homo sapiens OX=9606 GN=PGC PE=1 SV=1
11	AFDB:Q9DD89	0.869	0.862	1.612E-51	399	0.444	0.441	Q9DD89.pdb.gz
12	PDB:5ux4B	0.798	0.927	3.080E-45	340	0.434	0.506	5ux4B.pdb.gz	Development of 2-aminooxazoline 3-azaxanthene beta-amyloid cleaving enzyme (BACE) inhibitors with improved selectivity against Cathepsin D.
13	PDB:4amtA	0.824	0.931	9.551E-42	349	0.354	0.401	4amtA.pdb.gz
14	PDB:5mktA	0.766	0.917	1.212E-38	329	0.371	0.447	5mktA.pdb.gz
15	PDB:2bjuA	0.722	0.863	1.233E-31	329	0.280	0.337	2bjuA.pdb.gz	X-Ray Structure of Plasmepsin II Complexed with a Potent Achiral Inhibitor.
16	PDB:3qvcA	0.703	0.751	1.183E-28	368	0.240	0.258	3qvcA.pdb.gz
17	PDB:2qzwA	0.673	0.775	1.776E-25	341	0.237	0.276	2qzwA.pdb.gz
18	PDB:3aupA	0.561	0.587	5.920E-15	377	0.152	0.159	3aupA.pdb.gz
19	PDB:5lj5t	0.104	0.097	2.962E-1	438	0.076	0.068	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
20	PDB:3v0aB	0.098	0.055	5.176E-1	1150	0.076	0.026	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14091	0.0	814	396	1.000	1.000	CATE_HUMAN Cathepsin E OS=Homo sapiens OX=9606 GN=CTSE PE=1 SV=3
2	P16228	0.0	669	398	0.811	0.807	CATE_RAT Cathepsin E OS=Rattus norvegicus OX=10116 GN=Ctse PE=1 SV=3
3	P70269	0.0	660	397	0.801	0.798	CATE_MOUSE Cathepsin E OS=Mus musculus OX=10090 GN=Ctse PE=1 SV=2
4	Q805F3	0.0	558	397	0.682	0.680	CATEA_XENLA Cathepsin E-A OS=Xenopus laevis OX=8355 GN=ctse-a PE=1 SV=1
5	P0DJD8	8.72e-138	400	388	0.508	0.518	PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens OX=9606 GN=PGA3 PE=1 SV=1
6	P0DJD9	9.94e-138	400	388	0.508	0.518	PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens OX=9606 GN=PGA5 PE=1 SV=1
7	P0DJD7	1.31e-137	400	388	0.508	0.518	PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens OX=9606 GN=PGA4 PE=1 SV=1
8	Q9GK11	7.94e-128	375	381	0.485	0.504	CHYM_CAMDR Chymosin OS=Camelus dromedarius OX=9838 GN=CYM PE=1 SV=1
9	O93428	1.60e-126	372	396	0.475	0.475	CATD_CHIHA Cathepsin D OS=Chionodraco hamatus OX=36188 GN=ctsd PE=1 SV=2
10	Q8AWD9	1.07e-125	370	398	0.475	0.472	Q8AWD9_DANRE Cathepsin D OS=Danio rerio OX=7955 GN=catD PE=1 SV=1
11	P18242	1.41e-123	365	410	0.457	0.441	CATD_MOUSE Cathepsin D OS=Mus musculus OX=10090 GN=Ctsd PE=1 SV=1
12	P07339	9.29e-123	363	412	0.442	0.425	CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1
13	P24268	3.90e-122	361	407	0.452	0.440	CATD_RAT Cathepsin D OS=Rattus norvegicus OX=10116 GN=Ctsd PE=1 SV=1
14	Q05744	1.79e-120	357	398	0.444	0.442	CATD_CHICK Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 SV=1
15	P20142	9.75e-117	347	388	0.452	0.461	PEPC_HUMAN Gastricsin OS=Homo sapiens OX=9606 GN=PGC PE=1 SV=1
16	Q9D106	7.05e-116	344	387	0.462	0.473	PEPA5_MOUSE Pepsin A-5 OS=Mus musculus OX=10090 GN=Pga5 PE=1 SV=1
17	Q21966	2.66e-112	337	444	0.447	0.399	ASP4_CAEEL Aspartic protease 4 OS=Caenorhabditis elegans OX=6239 GN=asp-4 PE=2 SV=1
18	Q7K485	1.01e-110	332	392	0.412	0.416	Q7K485_DROME Cathepsin D OS=Drosophila melanogaster OX=7227 GN=cathD PE=1 SV=1
19	O09043	4.49e-110	331	419	0.455	0.430	NAPSA_MOUSE Napsin-A OS=Mus musculus OX=10090 GN=Napsa PE=1 SV=1
20	O96009	6.85e-110	330	420	0.434	0.410	NAPSA_HUMAN Napsin-A OS=Homo sapiens OX=9606 GN=NAPSA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07966 A1_Propeptide	0.00077	30.6	A1 Propeptide
2	PF00026 Asp	1.2e-121	417.6	Eukaryotic aspartyl protease
3	PF13650 Asp_protease_2	58	15.8	Aspartyl protease
4	PF14543 TAXi_N	6.3e-10	51.0	Xylanase inhibitor N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350911

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000009530	0.951	HLA class II histocompatibility antigen gamma chain
2	9606.ENSP00000339398	0.916	Major histocompatibility complex, class II, DQ alpha 1
3	9606.ENSP00000378786	0.911	HLA class II histocompatibility antigen, DR alpha chain
4	9606.ENSP00000393566	0.906	HLA class II histocompatibility antigen, DP alpha 1 chain
5	9606.ENSP00000353099	0.904	HLA class II histocompatibility antigen, DRB1-15 beta chain
6	9606.ENSP00000364076	0.904	HLA class II histocompatibility antigen, DQ alpha 2 chain
7	9606.ENSP00000364114	0.903	HLA class II histocompatibility antigen, DR beta 5 chain
8	9606.ENSP00000364080	0.902	HLA class II histocompatibility antigen, DQ beta 1 chain
9	9606.ENSP00000390431	0.902	Major histocompatibility complex, class II, DQ beta 2
10	9606.ENSP00000408146	0.900	HLA class II histocompatibility antigen, DP beta 1 chain
11	9606.ENSP00000345672	0.860	Cathepsin B
12	9606.ENSP00000264896	0.726	Lysosome membrane protein 2
13	9606.ENSP00000361562	0.726	Lysosomal protective protein
14	9606.ENSP00000345344	0.702	Cathepsin L1
15	9606.ENSP00000408411	0.688	Lysosome-associated membrane glycoprotein 2
16	9606.ENSP00000273920	0.678	Enolase-phosphatase E1
17	9606.ENSP00000383931	0.673	Platelet glycoprotein V
18	9606.ENSP00000362298	0.623	Sphingosine-1-phosphate lyase 1
19	9606.ENSP00000221086	0.621	Myotubularin-related protein 9
20	9606.ENSP00000333298	0.618	Lysosome-associated membrane glycoprotein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004190	1.000	aspartic-type endopeptidase activity
GO:0005488	0.808	binding
GO:0005515	0.782	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0002495	0.986	antigen processing and presentation of peptide antigen via MHC class II
GO:0002478	0.986	antigen processing and presentation of exogenous peptide antigen
GO:0043170	0.983	macromolecule metabolic process
GO:0019886	0.979	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0044238	0.977	primary metabolic process
GO:0006508	0.963	proteolysis
GO:0065007	0.598	biological regulation
GO:0050789	0.548	regulation of biological process
GO:0009987	0.400	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0031982	0.998	vesicle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031410	0.994	cytoplasmic vesicle
GO:0005768	0.974	endosome
GO:0005576	0.623	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	1.000	Aspartic endopeptidases.

[back to server]