StarFunc result for job id P14136

User Input

>input (432 residues)
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03995	0.650	0.653	2.853E-47	430	0.910	0.914	P03995.pdb.gz	GFAP_MOUSE Glial fibrillary acidic protein OS=Mus musculus OX=10090 GN=Gfap PE=1 SV=4
2	AFDB:F1RR02	0.460	0.432	4.191E-45	468	0.935	0.863	F1RR02.pdb.gz	F1RR02_PIG Glial fibrillary acidic protein OS=Sus scrofa OX=9823 GN=GFAP PE=1 SV=3
3	AFDB:A0A1W2PR46	0.409	0.361	6.704E-44	505	0.975	0.834	A0A1W2PR46.pdb.gz	A0A1W2PR46_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1
4	AFDB:Q58EE9	0.602	0.588	2.404E-36	444	0.664	0.646	Q58EE9.pdb.gz	GFAP_DANRE Glial fibrillary acidic protein OS=Danio rerio OX=7955 GN=gfap PE=1 SV=2
5	AFDB:F1NJ08	0.407	0.387	2.935E-31	460	0.572	0.537	F1NJ08.pdb.gz
6	AFDB:P02543	0.534	0.502	4.151E-31	466	0.567	0.526	P02543.pdb.gz	VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2
7	AFDB:F1QAM8	0.614	0.586	5.110E-31	455	0.542	0.514	F1QAM8.pdb.gz
8	AFDB:P48674	0.591	0.560	9.535E-31	461	0.556	0.521	P48674.pdb.gz	VIME_ONCMY Vimentin OS=Oncorhynchus mykiss OX=8022 GN=vim PE=2 SV=1
9	AFDB:P17661	0.551	0.515	1.660E-30	470	0.576	0.530	P17661.pdb.gz	DESM_HUMAN Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3
10	AFDB:P02542	0.496	0.467	8.760E-30	464	0.576	0.537	P02542.pdb.gz	DESM_CHICK Desmin OS=Gallus gallus OX=9031 GN=DES PE=1 SV=2
11	PDB:6v8oQ	0.053	0.082	3.771	264	0.014	0.023	6v8oQ.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
12	PDB:7q1dD	0.049	0.072	4.643	272	0.014	0.022	7q1dD.pdb.gz	3-N-alkylation in aminoglycoside antibiotic neomycin B overcomes bacterial resistance mediated by acetyltransferase (3) IIIa
13	PDB:4uv3A	0.044	0.069	6.126	248	0.025	0.044	4uv3A.pdb.gz
14	PDB:7edxQ	0.042	0.147	6.126	122	0.025	0.090	7edxQ.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:2ygdA	0.046	0.100	6.566	175	0.012	0.029	2ygdA.pdb.gz
16	PDB:4b2oA	0.053	0.082	6.566	264	0.021	0.034	4b2oA.pdb.gz	The Ymdb Phosphodiesterase is a Global Regulator of Late Adaptive Responses in Bacillus Subtilis.
17	PDB:5hynA	0.075	0.058	6.566	581	0.039	0.029	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
18	PDB:6fhmA	0.050	0.105	7.037	193	0.005	0.010	6fhmA.pdb.gz
19	PDB:3fb9A	0.049	0.190	7.542	89	0.005	0.022	3fb9A.pdb.gz
20	PDB:5otnA	0.050	0.123	7.542	156	0.009	0.026	5otnA.pdb.gz	MutT homologue 1 (MTH1) catalyzes the hydrolysis of mutagenic O6-methyl-dGTP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PR46	0.0	837	505	0.972	0.832	A0A1W2PR46_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1
2	A0A1W2PRT3	0.0	597	326	0.706	0.936	A0A1W2PRT3_HUMAN Glial fibrillary acidic protein (Fragment) OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1
3	F1RR02	0.0	733	468	0.919	0.848	F1RR02_PIG Glial fibrillary acidic protein OS=Sus scrofa OX=9823 GN=GFAP PE=1 SV=3
4	P03995	0.0	780	430	0.910	0.914	GFAP_MOUSE Glial fibrillary acidic protein OS=Mus musculus OX=10090 GN=Gfap PE=1 SV=4
5	P14136	0.0	864	432	1.000	1.000	GFAP_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1
6	P47819	0.0	764	430	0.917	0.921	GFAP_RAT Glial fibrillary acidic protein OS=Rattus norvegicus OX=10116 GN=Gfap PE=1 SV=2
7	Q28115	0.0	822	428	0.954	0.963	GFAP_BOVIN Glial fibrillary acidic protein OS=Bos taurus OX=9913 GN=GFAP PE=1 SV=2
8	Q58EE9	0.0	568	444	0.678	0.660	GFAP_DANRE Glial fibrillary acidic protein OS=Danio rerio OX=7955 GN=gfap PE=1 SV=2
9	P08670	1.72e-173	495	466	0.574	0.532	VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4
10	V9HWE1	1.72e-173	495	466	0.574	0.532	V9HWE1_HUMAN Epididymis luminal protein 113 OS=Homo sapiens OX=9606 GN=HEL113 PE=2 SV=1
11	P02543	2.14e-173	495	466	0.572	0.530	VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2
12	P02544	1.30e-172	493	465	0.574	0.533	VIME_MESAU Vimentin OS=Mesocricetus auratus OX=10036 GN=VIM PE=1 SV=2
13	P48670	2.00e-172	492	448	0.574	0.554	VIME_CRIGR Vimentin (Fragment) OS=Cricetulus griseus OX=10029 GN=VIM PE=2 SV=1
14	P48616	4.29e-172	492	466	0.574	0.532	VIME_BOVIN Vimentin OS=Bos taurus OX=9913 GN=VIM PE=1 SV=3
15	P20152	5.76e-172	491	466	0.556	0.515	VIME_MOUSE Vimentin OS=Mus musculus OX=10090 GN=Vim PE=1 SV=3
16	P31000	2.93e-171	489	466	0.558	0.517	VIME_RAT Vimentin OS=Rattus norvegicus OX=10116 GN=Vim PE=1 SV=2
17	P09654	1.92e-170	487	460	0.562	0.528	VIME_CHICK Vimentin OS=Gallus gallus OX=9031 GN=VIM PE=3 SV=2
18	P02542	4.56e-167	479	464	0.556	0.517	DESM_CHICK Desmin OS=Gallus gallus OX=9031 GN=DES PE=1 SV=2
19	O73665	1.28e-165	474	448	0.551	0.531	O73665_CHICK Desmin (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
20	P48674	2.99e-165	474	461	0.556	0.521	VIME_ONCMY Vimentin OS=Oncorhynchus mykiss OX=8022 GN=vim PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07889 DUF1664	38	15.8	Protein of unknown function (DUF1664)
2	PF00038 Filament	8e-106	365.8	Intermediate filament protein
3	PF04732 Filament_head	0.0016	30.5	Intermediate filament head (DNA binding) region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000015793

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000016898	0.857	Uncharacterized protein
2	9598.ENSPTRP00000016544	0.855	RNA binding protein fox-1 homolog
3	9598.ENSPTRP00000030665	0.851	Allograft inflammatory factor 1
4	9598.ENSPTRP00000038073	0.837	Proteolipid protein 1
5	9598.ENSPTRP00000028112	0.803	Pro-epidermal growth factor
6	9598.ENSPTRP00000022659	0.801	Major prion protein
7	9598.ENSPTRP00000023861	0.793	Oligodendrocyte lineage transcription factor 2
8	9598.ENSPTRP00000024154	0.790	S100 calcium binding protein B
9	9598.ENSPTRP00000014826	0.787	CD68 molecule
10	9598.ENSPTRP00000037577	0.786	Synaptophysin
11	9598.ENSPTRP00000039947	0.769	Microtubule-associated protein 2
12	9598.ENSPTRP00000056200	0.733	Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity)
13	9598.ENSPTRP00000056218	0.729	Uncharacterized protein
14	9598.ENSPTRP00000046752	0.728	SRY-box 2
15	9598.ENSPTRP00000028196	0.721	Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.
16	9598.ENSPTRP00000017919	0.705	ELAV-like protein
17	9598.ENSPTRP00000014499	0.702	Tubulin beta chain
18	9598.ENSPTRP00000045813	0.701	Uncharacterized protein
19	9598.ENSPTRP00000011226	0.687	Uncharacterized protein
20	9598.ENSPTRP00000028807	0.686	Amino acid transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.983	structural molecule activity
GO:0005200	0.956	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009894	0.985	regulation of catabolic process
GO:0050794	0.968	regulation of cellular process
GO:0042176	0.885	regulation of protein catabolic process
GO:0031323	0.791	regulation of cellular metabolic process
GO:0031329	0.716	regulation of cellular catabolic process
GO:0009987	0.714	cellular process
GO:0048518	0.449	positive regulation of biological process
GO:0048522	0.408	positive regulation of cellular process
GO:0050896	0.353	response to stimulus
GO:0010506	0.324	regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0045111	0.980	intermediate filament cytoskeleton
GO:0099080	0.962	supramolecular complex
GO:0099512	0.950	supramolecular fiber
GO:0099513	0.933	polymeric cytoskeletal fiber
GO:0016020	0.411	membrane
GO:0005882	0.384	intermediate filament
GO:0005576	0.370	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]