StarFunc result for job id P14138

User Input

>input (238 residues)
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAG
PGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINT
PEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVS
SNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14138	0.999	0.999	4.104E-38	238	1.000	1.000	P14138.pdb.gz	EDN3_HUMAN Endothelin-3 OS=Homo sapiens OX=9606 GN=EDN3 PE=1 SV=1
2	AFDB:P48299	0.260	0.280	6.053E-18	214	0.550	0.612	P48299.pdb.gz	EDN3_MOUSE Endothelin-3 OS=Mus musculus OX=10090 GN=Edn3 PE=2 SV=1
3	AFDB:E7EYK9	0.105	0.076	1.269E-1	420	0.172	0.098	E7EYK9.pdb.gz
4	AFDB:O01465	0.081	0.048	2.030E-1	588	0.197	0.080	O01465.pdb.gz	O01465_CAEEL Ground-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grd-9 PE=4 SV=2
5	AFDB:A0A0G2K5P5	0.115	0.021	2.322E-1	1688	0.143	0.020	A0A0G2K5P5.pdb.gz	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
6	AFDB:Q498K9	0.106	0.070	5.195E-1	380	0.160	0.100	Q498K9.pdb.gz	L14BB_XENLA Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1
7	AFDB:Q8NEA6	0.106	0.040	1.162	775	0.193	0.059	Q8NEA6.pdb.gz	GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens OX=9606 GN=GLIS3 PE=1 SV=5
8	AFDB:Q9HAI6	0.094	0.086	1.162	301	0.130	0.103	Q9HAI6.pdb.gz	TASL_HUMAN TLR adapter interacting with SLC15A4 on the lysosome OS=Homo sapiens OX=9606 GN=TASL PE=1 SV=1
9	AFDB:F4J3P7	0.107	0.062	1.626	442	0.105	0.057	F4J3P7.pdb.gz	PHLD_ARATH Myb family transcription factor PHL13 OS=Arabidopsis thaliana OX=3702 GN=PHL13 PE=2 SV=1
10	AFDB:Q9VUX7	0.104	0.076	1.626	377	0.122	0.077	Q9VUX7.pdb.gz	Q9VUX7_DROME GH16214p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
11	PDB:7odrl	0.111	0.298	7.226	82	0.034	0.098	7odrl.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
12	PDB:7odrd	0.072	0.066	8.837	259	0.046	0.042	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14138	2.51e-178	490	238	1.000	1.000	EDN3_HUMAN Endothelin-3 OS=Homo sapiens OX=9606 GN=EDN3 PE=1 SV=1
2	P48299	1.06e-79	240	214	0.538	0.598	EDN3_MOUSE Endothelin-3 OS=Mus musculus OX=10090 GN=Edn3 PE=2 SV=1
3	P13207	1.57e-49	161	167	0.378	0.539	EDN3_RAT Endothelin-3 OS=Rattus norvegicus OX=10116 GN=Edn3 PE=2 SV=3
4	E9QFS0	1.55e-26	102	153	0.210	0.327	E9QFS0_DANRE Endothelin 3b OS=Danio rerio OX=7955 GN=EDN3 PE=2 SV=1
5	P22387	8.32e-25	99.4	202	0.239	0.282	EDN1_MOUSE Endothelin-1 OS=Mus musculus OX=10090 GN=Edn1 PE=1 SV=3
6	P05305	4.89e-20	87.0	212	0.218	0.245	EDN1_HUMAN Endothelin-1 OS=Homo sapiens OX=9606 GN=EDN1 PE=1 SV=1
7	P22388	1.52e-19	85.5	202	0.210	0.248	EDN1_RAT Endothelin-1 OS=Rattus norvegicus OX=10116 GN=Edn1 PE=1 SV=2
8	Q9I8G3	4.71e-19	83.6	188	0.185	0.234	Q9I8G3_DANRE Endothelin 1 OS=Danio rerio OX=7955 GN=et-1 PE=2 SV=1
9	P20800	2.00e-17	79.0	178	0.160	0.213	EDN2_HUMAN Endothelin-2 OS=Homo sapiens OX=9606 GN=EDN2 PE=1 SV=2
10	P23943	2.88e-16	75.9	176	0.181	0.244	EDN2_RAT Endothelin-2 OS=Rattus norvegicus OX=10116 GN=Edn2 PE=2 SV=2
11	P22389	1.91e-15	73.6	175	0.168	0.229	EDN2_MOUSE Endothelin-2 OS=Mus musculus OX=10090 GN=Edn2 PE=2 SV=3
12	P9WG01	0.20	34.7	274	0.109	0.095	SUGB_MYCTU Trehalose transport system permease protein SugB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sugB PE=1 SV=1
13	Q9V3F9	2.5	31.6	655	0.092	0.034	Q9V3F9_DROME BcDNA.LD28120 OS=Drosophila melanogaster OX=7227 GN=out PE=2 SV=1
14	A8AZP4	3.9	31.2	3646	0.063	0.004	PADA_STRGC Platelet adherence protein A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=padA PE=1 SV=1
15	Q5AUX1	4.0	31.2	2103	0.067	0.008	ORSA_EMENI Orsellinic acid synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=orsA PE=1 SV=1
16	Q9UQ05	6.6	30.4	1017	0.113	0.027	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
17	Q9HTH9	6.8	29.6	159	0.067	0.101	Q9HTH9_PSEAE CdhB, Carnitine dehydrogenase-related protein B OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cdhB PE=4 SV=1
18	F1RBL6	8.3	30.0	411	0.092	0.054	F1RBL6_DANRE Cytohesin 4a OS=Danio rerio OX=7955 GN=cyth4a PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00322 Endothelin	1.1e-14	64.8	Endothelin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337128

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315011	0.999	Endothelin-1 receptor
2	9606.ENSP00000366416	0.999	Endothelin receptor type B
3	9606.ENSP00000347409	0.966	Kell blood group glycoprotein
4	9606.ENSP00000367879	0.914	Membrane transport protein XK
5	9606.ENSP00000368683	0.848	Endothelin-1
6	9606.ENSP00000361668	0.841	Endothelin-2
7	9606.ENSP00000380093	0.801	Transcription factor SOX-10
8	9606.ENSP00000364028	0.800	Endothelin-converting enzyme 1
9	9606.ENSP00000276414	0.775	Progonadoliberin-1
10	9606.ENSP00000384223	0.715	Endothelin-converting enzyme 2
11	9606.ENSP00000228280	0.714	Kit ligand
12	9606.ENSP00000265023	0.696	Kininogen-1
13	9606.ENSP00000256857	0.685	Gastrin-releasing peptide
14	9606.ENSP00000321106	0.660	Protachykinin-1
15	9606.ENSP00000354859	0.642	D(2) dopamine receptor
16	9606.ENSP00000409007	0.634	Glial cell line-derived neurotrophic factor
17	9606.ENSP00000360069	0.633	Zinc finger protein 831
18	9606.ENSP00000271331	0.630	Prokineticin-1
19	9606.ENSP00000349003	0.626	Prostaglandin E2 receptor EP3 subtype
20	9606.ENSP00000305372	0.625	Beta-2 adrenergic receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031708	1.000	endothelin B receptor binding
GO:0005179	1.000	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0009987	0.976	cellular process
GO:0050794	0.972	regulation of cellular process
GO:0065008	0.970	regulation of biological quality
GO:0050896	0.967	response to stimulus
GO:0032501	0.962	multicellular organismal process
GO:0023052	0.951	signaling
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0080090	0.935	regulation of primary metabolic process
GO:0051171	0.935	regulation of nitrogen compound metabolic process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0048518	0.922	positive regulation of biological process
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0051716	0.909	cellular response to stimulus
GO:0032879	0.909	regulation of localization
GO:0048522	0.900	positive regulation of cellular process
GO:0007165	0.898	signal transduction
GO:0008015	0.891	blood circulation
GO:0042221	0.885	response to chemical
GO:0042310	0.883	vasoconstriction
GO:0003073	0.880	regulation of systemic arterial blood pressure
GO:0009967	0.878	positive regulation of signal transduction
GO:0032101	0.877	regulation of response to external stimulus
GO:0051049	0.874	regulation of transport
GO:0003044	0.870	regulation of systemic arterial blood pressure mediated by a chemical signal
GO:0051239	0.861	regulation of multicellular organismal process
GO:0050921	0.855	positive regulation of chemotaxis
GO:0051246	0.851	regulation of protein metabolic process
GO:0002685	0.846	regulation of leukocyte migration
GO:0042127	0.838	regulation of cell population proliferation
GO:0051050	0.833	positive regulation of transport
GO:1902533	0.820	positive regulation of intracellular signal transduction
GO:0019220	0.805	regulation of phosphate metabolic process
GO:0042325	0.801	regulation of phosphorylation
GO:0051338	0.799	regulation of transferase activity
GO:0002684	0.797	positive regulation of immune system process
GO:0044057	0.792	regulation of system process
GO:0031325	0.785	positive regulation of cellular metabolic process
GO:0007267	0.778	cell-cell signaling
GO:0051173	0.770	positive regulation of nitrogen compound metabolic process
GO:0051347	0.754	positive regulation of transferase activity
GO:0051240	0.751	positive regulation of multicellular organismal process
GO:0006939	0.747	smooth muscle contraction
GO:0070887	0.716	cellular response to chemical stimulus
GO:0045859	0.709	regulation of protein kinase activity
GO:0045787	0.693	positive regulation of cell cycle
GO:0010468	0.692	regulation of gene expression
GO:1903522	0.687	regulation of blood circulation
GO:0051247	0.678	positive regulation of protein metabolic process
GO:0051130	0.664	positive regulation of cellular component organization
GO:0050886	0.646	endocrine process
GO:0006810	0.640	transport
GO:0030595	0.632	leukocyte chemotaxis
GO:0097529	0.631	myeloid leukocyte migration
GO:0010817	0.625	regulation of hormone levels
GO:0045823	0.618	positive regulation of heart contraction
GO:0046879	0.602	hormone secretion
GO:0010564	0.598	regulation of cell cycle process
GO:0071621	0.597	granulocyte chemotaxis
GO:2000147	0.595	positive regulation of cell motility
GO:0008284	0.593	positive regulation of cell population proliferation
GO:0007346	0.571	regulation of mitotic cell cycle
GO:0035556	0.568	intracellular signal transduction
GO:1903530	0.563	regulation of secretion by cell
GO:0032502	0.555	developmental process
GO:0048856	0.548	anatomical structure development
GO:0030593	0.546	neutrophil chemotaxis
GO:0050793	0.533	regulation of developmental process
GO:0030335	0.529	positive regulation of cell migration
GO:0007186	0.424	G protein-coupled receptor signaling pathway
GO:0071702	0.381	organic substance transport
GO:0007275	0.329	multicellular organism development
GO:0048519	0.313	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.719	intracellular anatomical structure
GO:0005737	0.603	cytoplasm
GO:0043226	0.558	organelle
GO:0043227	0.543	membrane-bounded organelle
GO:0043229	0.528	intracellular organelle
GO:0016020	0.490	membrane
GO:0043231	0.419	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]