StarFunc result for job id P14151

User Input

>input (372 residues)
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN
NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC
NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT
CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSKRSMNDPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14151	1.000	1.000	1.656E-73	372	1.000	1.000	P14151.pdb.gz	LYAM1_HUMAN L-selectin OS=Homo sapiens OX=9606 GN=SELL PE=1 SV=2
2	AFDB:P30836	0.769	0.769	7.371E-63	372	0.772	0.772	P30836.pdb.gz	LYAM1_RAT L-selectin OS=Rattus norvegicus OX=10116 GN=Sell PE=2 SV=1
3	AFDB:P18337	0.803	0.803	1.038E-61	372	0.763	0.763	P18337.pdb.gz	LYAM1_MOUSE L-selectin OS=Mus musculus OX=10090 GN=Sell PE=1 SV=1
4	AFDB:P98131	0.773	0.777	1.613E-61	370	0.763	0.768	P98131.pdb.gz	LYAM1_BOVIN L-selectin OS=Bos taurus OX=9913 GN=SELL PE=2 SV=1
5	AFDB:Q01102	0.656	0.334	2.097E-43	768	0.427	0.207	Q01102.pdb.gz	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
6	AFDB:P98106	0.583	0.310	3.890E-42	768	0.422	0.204	P98106.pdb.gz	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
7	AFDB:Q00690	0.651	0.416	6.749E-42	612	0.390	0.237	Q00690.pdb.gz	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
8	AFDB:P16109	0.483	0.221	5.787E-41	830	0.438	0.196	P16109.pdb.gz	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
9	AFDB:P16581	0.633	0.403	2.294E-40	610	0.401	0.244	P16581.pdb.gz	LYAM2_HUMAN E-selectin OS=Homo sapiens OX=9606 GN=SELE PE=1 SV=1
10	AFDB:P98105	0.633	0.450	3.565E-40	549	0.390	0.264	P98105.pdb.gz	LYAM2_RAT E-selectin OS=Rattus norvegicus OX=10116 GN=Sele PE=2 SV=1
11	PDB:1c1zA	0.232	0.259	1.940E-11	326	0.118	0.135	1c1zA.pdb.gz
12	PDB:2gsxA	0.171	0.082	1.985E-9	951	0.113	0.044	2gsxA.pdb.gz
13	PDB:2xwbF	0.188	0.105	1.292E-8	714	0.108	0.056	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
14	PDB:2q7zA	0.189	0.052	1.799E-8	1931	0.129	0.025	2q7zA.pdb.gz
15	PDB:7wz8A	0.273	0.543	1.460E-7	180	0.121	0.250	7wz8A.pdb.gz
16	PDB:7ufgB	0.265	0.092	3.936E-7	1182	0.105	0.033	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7ufgA	0.266	0.097	4.394E-7	1151	0.105	0.034	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:5f2qB	0.260	0.668	4.906E-7	135	0.089	0.244	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
19	PDB:4e0sB	0.173	0.082	3.981E-6	898	0.089	0.037	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:3t5oA	0.232	0.120	4.697E-6	871	0.086	0.037	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14151	0.0	775	372	1.000	1.000	LYAM1_HUMAN L-selectin OS=Homo sapiens OX=9606 GN=SELL PE=1 SV=2
2	P18337	0.0	606	372	0.761	0.761	LYAM1_MOUSE L-selectin OS=Mus musculus OX=10090 GN=Sell PE=1 SV=1
3	P30836	0.0	592	372	0.772	0.772	LYAM1_RAT L-selectin OS=Rattus norvegicus OX=10116 GN=Sell PE=2 SV=1
4	P98131	0.0	624	370	0.763	0.768	LYAM1_BOVIN L-selectin OS=Bos taurus OX=9913 GN=SELL PE=2 SV=1
5	P16109	2.00e-108	338	830	0.427	0.192	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
6	Q01102	4.82e-106	330	768	0.422	0.204	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
7	P98106	5.77e-105	327	768	0.409	0.198	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
8	P16581	3.54e-102	316	610	0.395	0.241	LYAM2_HUMAN E-selectin OS=Homo sapiens OX=9606 GN=SELE PE=1 SV=1
9	P98105	9.35e-101	310	549	0.392	0.266	LYAM2_RAT E-selectin OS=Rattus norvegicus OX=10116 GN=Sele PE=2 SV=1
10	Q00690	4.06e-100	310	612	0.390	0.237	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
11	E5DV48	4.43e-95	304	868	0.403	0.173	E5DV48_DANRE P-selectin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-260g14.4 PE=2 SV=1
12	A2AVA0	2.98e-16	83.2	3567	0.151	0.016	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
13	Q4LDE5	5.54e-15	79.3	3571	0.164	0.017	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
14	Q9VYR4	4.90e-13	72.8	1174	0.194	0.061	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
15	A0A1D5NSM8	1.89e-12	71.2	3615	0.142	0.015	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
16	P91658	2.09e-12	70.9	974	0.191	0.073	P91658_DROME Furrowed OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
17	Q09101	3.87e-11	67.0	958	0.126	0.049	HIG_DROME Locomotion-related protein Hikaru genki OS=Drosophila melanogaster OX=7227 GN=hig PE=1 SV=2
18	P28175	4.35e-11	67.0	1019	0.148	0.054	CFC_TACTR Clotting factor C OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
19	Q9VQX3	2.11e-10	63.9	359	0.099	0.103	Q9VQX3_DROME HL05328p OS=Drosophila melanogaster OX=7227 GN=lectin-24Db PE=2 SV=1
20	Q8INW2	2.09e-09	61.6	1676	0.097	0.021	Q8INW2_DROME Hig-anchoring scaffold protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Hasp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	1.1	21.0	EGF-like domain
2	PF07974 EGF_2	8.9	18.1	EGF-like domain
3	PF12947 EGF_3	1.1e+02	14.5	EGF domain
4	PF12661 hEGF	6.1	18.9	Human growth factor-like EGF
5	PF00059 Lectin_C	3.2e-21	87.4	Lectin C-type domain
6	PF15879 MWFE	4.6e+02	12.4	NADH-ubiquinone oxidoreductase MWFE subunit
7	PF06247 Plasmod_Pvs28	1.8e+02	13.8	Pvs28 EGF domain
8	PF00084 Sushi	2.2e-06	39.4	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236147

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215637	0.997	Mucosal addressin cell adhesion molecule 1
2	9606.ENSP00000228463	0.997	P-selectin glycoprotein ligand 1
3	9606.ENSP00000310036	0.997	Hematopoietic progenitor cell antigen CD34
4	9606.ENSP00000287706	0.989	Protein N-terminal asparagine amidohydrolase
5	9606.ENSP00000367817	0.988	Podocalyxin
6	9606.ENSP00000356042	0.970	Ezrin
7	9606.ENSP00000265077	0.965	Versican core protein
8	9606.ENSP00000353408	0.960	Moesin
9	9606.ENSP00000411355	0.941	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000345359	0.937	Podocalyxin-like protein 2
11	9606.ENSP00000011653	0.917	T-cell surface glycoprotein CD4
12	9606.ENSP00000246657	0.910	C-C chemokine receptor type 7
13	9606.ENSP00000228434	0.909	Early activation antigen CD69
14	9606.ENSP00000441691	0.903	Integrin alpha-M
15	9606.ENSP00000398632	0.893	CD44 antigen
16	9606.ENSP00000349467	0.890	Calmodulin-1
17	9606.ENSP00000386559	0.888	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000365380	0.867	Forkhead box protein P3
19	9606.ENSP00000303939	0.865	Cytotoxic T-lymphocyte protein 4
20	9606.ENSP00000324890	0.860	T-cell-specific surface glycoprotein CD28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0051861	0.995	glycolipid binding
GO:0043167	0.989	ion binding
GO:0070492	0.957	oligosaccharide binding
GO:0005509	0.957	calcium ion binding
GO:0005539	0.946	glycosaminoglycan binding
GO:1901681	0.940	sulfur compound binding
GO:0008201	0.927	heparin binding
GO:0043208	0.751	glycosphingolipid binding
GO:0005102	0.526	signaling receptor binding
GO:0019899	0.524	enzyme binding
GO:0038023	0.502	signaling receptor activity
GO:0002020	0.389	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.967	response to stimulus
GO:0002376	0.967	immune system process
GO:0050794	0.889	regulation of cellular process
GO:0048518	0.825	positive regulation of biological process
GO:0007155	0.816	cell adhesion
GO:0050900	0.810	leukocyte migration
GO:0098609	0.742	cell-cell adhesion
GO:0007159	0.675	leukocyte cell-cell adhesion
GO:0048522	0.664	positive regulation of cellular process
GO:0045123	0.574	cellular extravasation
GO:0048583	0.572	regulation of response to stimulus
GO:0098742	0.500	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0002682	0.435	regulation of immune system process
GO:0042221	0.433	response to chemical
GO:0051716	0.419	cellular response to stimulus
GO:0016339	0.408	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0006950	0.364	response to stress
GO:0002684	0.350	positive regulation of immune system process
GO:0048584	0.317	positive regulation of response to stimulus
GO:0007154	0.306	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.992	endomembrane system
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005737	0.984	cytoplasm
GO:0005886	0.977	plasma membrane
GO:0031982	0.908	vesicle
GO:0031410	0.802	cytoplasmic vesicle
GO:0031090	0.772	organelle membrane
GO:0098588	0.693	bounding membrane of organelle
GO:0099503	0.385	secretory vesicle
GO:0030141	0.358	secretory granule
GO:0009986	0.343	cell surface
GO:0030667	0.318	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]