StarFunc result for job id P14174

User Input

>input (115 residues)
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I4AY87	0.999	0.999	1.012E-25	115	1.000	1.000	I4AY87.pdb.gz	I4AY87_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=MIF PE=2 SV=1
2	AFDB:P34884	0.999	0.999	3.296E-24	115	0.896	0.896	P34884.pdb.gz	MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus OX=10090 GN=Mif PE=1 SV=2
3	PDB:1gczA	0.978	0.954	4.291E-23	118	0.983	0.958	1gczA.pdb.gz	Coumarin and chromen-4-one analogues as tautomerase inhibitors of macrophage migration inhibitory factor: discovery and X-ray crystallography.
4	AFDB:Q02960	0.998	0.998	2.823E-22	115	0.713	0.713	Q02960.pdb.gz	MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus OX=9031 GN=MIF PE=3 SV=3
5	PDB:1mfiA	0.977	0.986	3.446E-21	114	0.878	0.886	1mfiA.pdb.gz	Crystal structure of macrophage migration inhibitory factor complexed with (E)-2-fluoro-p-hydroxycinnamate at 1.8 A resolution: implications for enzymatic catalysis and inhibition.
6	AFDB:Q0ZBR7	0.992	0.992	2.579E-20	115	0.687	0.687	Q0ZBR7.pdb.gz	Q0ZBR7_DANRE Macrophage migration inhibitory factor OS=Danio rerio OX=7955 GN=MIF PE=1 SV=1
7	AFDB:A4GRE3	0.975	0.943	6.159E-15	119	0.330	0.319	A4GRE3.pdb.gz	A4GRE3_9BILA Macrophage migration inhibitory factor OS=Ancylostoma ceylanicum OX=53326 PE=1 SV=1
8	PDB:7mw7A	0.927	0.905	3.944E-14	118	0.339	0.331	7mw7A.pdb.gz
9	PDB:2os5A	0.953	0.929	4.786E-14	118	0.313	0.305	2os5A.pdb.gz
10	AFDB:O35215	0.940	0.917	5.519E-14	118	0.304	0.297	O35215.pdb.gz	DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus OX=10090 GN=Ddt PE=1 SV=3
11	AFDB:P30046	0.938	0.915	8.668E-14	118	0.348	0.339	P30046.pdb.gz	DOPD_HUMAN D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3
12	AFDB:F1QJV7	0.933	0.911	2.952E-13	118	0.313	0.305	F1QJV7.pdb.gz
13	PDB:3kerA	0.915	0.900	8.719E-13	117	0.287	0.282	3kerA.pdb.gz	Targeting distinct tautomerase sites of D-DT and MIF with a single molecule for inhibition of neutrophil lung recruitment.
14	AFDB:P90835	0.934	0.742	1.144E-12	146	0.270	0.212	P90835.pdb.gz	MIF3_CAEEL MIF-like protein mif-3 OS=Caenorhabditis elegans OX=6239 GN=mif-3 PE=3 SV=1
15	AFDB:F4KAK0	0.833	0.826	8.446E-12	116	0.287	0.284	F4KAK0.pdb.gz	F4KAK0_ARATH Tautomerase/MIF superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MUL3.12 PE=1 SV=1
16	PDB:2wkfB	0.717	0.790	1.609E-7	103	0.243	0.272	2wkfB.pdb.gz
17	PDB:5hp5A	0.210	0.050	2.783E-2	669	0.061	0.010	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
18	PDB:2opaA	0.434	0.773	1.806E-1	61	0.043	0.082	2opaA.pdb.gz	The Crystal Structure of YwhB, a 4-Oxalocrotonate Tautomerase Homologue from Bacillus subtilis: the Structural Basis for Catalysis, Inhibition, and Reaction Stereoselectivity.
19	PDB:7ajtCM	0.222	0.105	2.660E-1	360	0.113	0.036	7ajtCM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:5nrlD	0.192	0.172	2.837E-1	142	0.096	0.077	5nrlD.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I4AY87	1.11e-83	241	115	1.000	1.000	I4AY87_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=MIF PE=2 SV=1
2	P14174	1.11e-83	241	115	1.000	1.000	MIF_HUMAN Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4
3	P30904	3.87e-76	222	115	0.904	0.904	MIF_RAT Macrophage migration inhibitory factor OS=Rattus norvegicus OX=10116 GN=Mif PE=1 SV=4
4	P34884	1.37e-75	221	115	0.896	0.896	MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus OX=10090 GN=Mif PE=1 SV=2
5	Q02960	6.80e-63	189	115	0.713	0.713	MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus OX=9031 GN=MIF PE=3 SV=3
6	Q0ZBR7	1.76e-55	170	115	0.687	0.687	Q0ZBR7_DANRE Macrophage migration inhibitory factor OS=Danio rerio OX=7955 GN=MIF PE=1 SV=1
7	A4GRE3	4.81e-20	80.5	119	0.339	0.328	A4GRE3_9BILA Macrophage migration inhibitory factor OS=Ancylostoma ceylanicum OX=53326 PE=1 SV=1
8	P30046	8.84e-18	74.7	118	0.348	0.339	DOPD_HUMAN D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3
9	Q6IQL4	1.24e-16	71.6	118	0.322	0.314	Q6IQL4_DANRE D-dopachrome decarboxylase OS=Danio rerio OX=7955 GN=zgc:86714 PE=1 SV=1
10	O35215	2.95e-15	68.2	118	0.304	0.297	DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus OX=10090 GN=Ddt PE=1 SV=3
11	P80254	5.83e-15	67.4	118	0.304	0.297	DOPD_RAT D-dopachrome decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddt PE=1 SV=3
12	A6NHG4	7.41e-14	65.1	134	0.330	0.284	DDTL_HUMAN D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1
13	F4KAK0	1.01e-11	58.9	116	0.296	0.293	F4KAK0_ARATH Tautomerase/MIF superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MUL3.12 PE=1 SV=1
14	Q8I5C5	1.48e-10	56.2	116	0.278	0.276	Q8I5C5_PLAF7 Macrophage migration inhibitory factor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1229400 PE=1 SV=1
15	F4K9G5	2.12e-10	55.8	122	0.270	0.254	F4K9G5_ARATH Tautomerase/MIF superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g01650 PE=1 SV=1
16	P90835	8.75e-09	52.0	146	0.270	0.212	MIF3_CAEEL MIF-like protein mif-3 OS=Caenorhabditis elegans OX=6239 GN=mif-3 PE=3 SV=1
17	Q8LG92	1.04e-07	48.5	112	0.261	0.268	Q8LG92_ARATH LS1-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g51660 PE=1 SV=1
18	F4IXW2	4.6	28.9	1739	0.122	0.008	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
19	Q9M2R0	8.0	28.1	773	0.165	0.025	FTIP3_ARATH FT-interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=FTIP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01344 Kelch_1	2.3e+02	12.8	Kelch motif
2	PF01187 MIF	3e-48	174.3	Macrophage migration inhibitory factor (MIF)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007237

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000002030	0.911	Aspartate aminotransferase
2	60711.ENSCSAP00000007743	0.910	CD74 molecule, major histocompatibility complex, class II invariant chain
3	60711.ENSCSAP00000001022	0.909	Aspartate aminotransferase
4	60711.ENSCSAP00000015853	0.908	4-hydroxyphenylpyruvate dioxygenase
5	60711.ENSCSAP00000000628	0.905	Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate
6	60711.ENSCSAP00000011600	0.900	Glutamic-oxaloacetic transaminase 1-like 1
7	60711.ENSCSAP00000015627	0.900	Amine oxidase
8	60711.ENSCSAP00000012365	0.732	Chemokine (C-X-C motif) receptor 4
9	60711.ENSCSAP00000018294	0.715	Chemokine (C-X-C motif) receptor 2
10	60711.ENSCSAP00000010231	0.658	COP9 signalosome subunit 5
11	60711.ENSCSAP00000007217	0.623	D-dopachrome tautomerase-like
12	60711.ENSCSAP00000006483	0.584	Heat shock protein 90kDa alpha (cytosolic), class A member 1
13	60711.ENSCSAP00000002649	0.552	Chemokine (C-C motif) ligand 2
14	60711.ENSCSAP00000001821	0.550	NME/NM23 nucleoside diphosphate kinase 1
15	60711.ENSCSAP00000001109	0.546	Multifunctional fusion protein
16	60711.ENSCSAP00000008254	0.545	Signal transducer and activator of transcription 4
17	60711.ENSCSAP00000007551	0.527	Acts as a tumor suppressor in many tumor types
18	60711.ENSCSAP00000002109	0.516	Keratin 7
19	60711.ENSCSAP00000002848	0.511	Eukaryotic translation elongation factor 1 gamma
20	60711.ENSCSAP00000010052	0.511	Interleukin 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016860	1.000	intramolecular oxidoreductase activity
GO:0005125	1.000	cytokine activity
GO:0005126	0.823	cytokine receptor binding
GO:0042802	0.819	identical protein binding
GO:0016863	0.768	intramolecular oxidoreductase activity, transposing C=C bonds
GO:0019899	0.763	enzyme binding
GO:0042056	0.736	chemoattractant activity
GO:0050178	0.613	phenylpyruvate tautomerase activity
GO:0002020	0.528	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.992	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0048518	0.973	positive regulation of biological process
GO:0048522	0.964	positive regulation of cellular process
GO:0048583	0.960	regulation of response to stimulus
GO:0019222	0.913	regulation of metabolic process
GO:0048523	0.879	negative regulation of cellular process
GO:0048584	0.868	positive regulation of response to stimulus
GO:0080134	0.803	regulation of response to stress
GO:0010941	0.796	regulation of cell death
GO:0051716	0.793	cellular response to stimulus
GO:0043067	0.789	regulation of programmed cell death
GO:0042981	0.776	regulation of apoptotic process
GO:0002682	0.743	regulation of immune system process
GO:0042325	0.726	regulation of phosphorylation
GO:0060255	0.716	regulation of macromolecule metabolic process
GO:0032101	0.713	regulation of response to external stimulus
GO:0002684	0.709	positive regulation of immune system process
GO:0060548	0.706	negative regulation of cell death
GO:0045937	0.699	positive regulation of phosphate metabolic process
GO:0008152	0.696	metabolic process
GO:0051171	0.690	regulation of nitrogen compound metabolic process
GO:0051173	0.682	positive regulation of nitrogen compound metabolic process
GO:0080090	0.679	regulation of primary metabolic process
GO:0009966	0.656	regulation of signal transduction
GO:0051247	0.650	positive regulation of protein metabolic process
GO:0001932	0.648	regulation of protein phosphorylation
GO:1902533	0.623	positive regulation of intracellular signal transduction
GO:0031401	0.617	positive regulation of protein modification process
GO:0071704	0.595	organic substance metabolic process
GO:0042327	0.587	positive regulation of phosphorylation
GO:0044237	0.583	cellular metabolic process
GO:0048585	0.563	negative regulation of response to stimulus
GO:0010468	0.506	regulation of gene expression
GO:0051239	0.498	regulation of multicellular organismal process
GO:0001934	0.489	positive regulation of protein phosphorylation
GO:0023052	0.467	signaling
GO:0007154	0.466	cell communication
GO:0007165	0.461	signal transduction
GO:0043066	0.458	negative regulation of apoptotic process
GO:0044238	0.446	primary metabolic process
GO:0010628	0.441	positive regulation of gene expression
GO:0042127	0.438	regulation of cell population proliferation
GO:0042221	0.420	response to chemical
GO:0032501	0.416	multicellular organismal process
GO:0051240	0.406	positive regulation of multicellular organismal process
GO:0006950	0.395	response to stress
GO:0080135	0.385	regulation of cellular response to stress
GO:0051049	0.374	regulation of transport
GO:0040012	0.365	regulation of locomotion
GO:0032502	0.361	developmental process
GO:0030334	0.357	regulation of cell migration
GO:0065009	0.350	regulation of molecular function
GO:0006807	0.341	nitrogen compound metabolic process
GO:0070887	0.325	cellular response to chemical stimulus
GO:0009968	0.325	negative regulation of signal transduction
GO:0009892	0.316	negative regulation of metabolic process
GO:0001817	0.315	regulation of cytokine production
GO:0001819	0.306	positive regulation of cytokine production
GO:0010033	0.300	response to organic substance
GO:0008284	0.300	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	0.999	extracellular space
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0012505	0.993	endomembrane system
GO:0005829	0.972	cytosol
GO:0031982	0.927	vesicle
GO:0065010	0.918	extracellular membrane-bounded organelle
GO:0016020	0.908	membrane
GO:0070062	0.900	extracellular exosome
GO:0031410	0.873	cytoplasmic vesicle
GO:0071944	0.817	cell periphery
GO:0005886	0.723	plasma membrane
GO:0030141	0.326	secretory granule
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.3.-.-	1.000	Intramolecular oxidoreductases.
EC:5.3.3.-	0.768	Transposing C=C bonds.
RHEA:17097	0.613	3-phenylpyruvate = enol-phenylpyruvate
EC:5.3.2.1	0.613	phenylpyruvate tautomerase.

[back to server]