StarFunc result for job id P14210

User Input

>input (728 residues)
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1D5PAR6	0.512	0.514	0.000	726	0.749	0.751	A0A1D5PAR6.pdb.gz
2	AFDB:P14210	1.000	1.000	0.000	728	1.000	1.000	P14210.pdb.gz	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2
3	AFDB:F6PA78	0.495	0.522	5.793E-93	685	0.446	0.474	F6PA78.pdb.gz
4	AFDB:A4IGA7	0.466	0.476	1.068E-91	712	0.455	0.465	A4IGA7.pdb.gz
5	AFDB:P26927	0.470	0.480	2.009E-82	711	0.418	0.428	P26927.pdb.gz	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
6	AFDB:Q5XFY1	0.528	0.538	4.144E-81	709	0.416	0.427	Q5XFY1.pdb.gz
7	AFDB:P26928	0.526	0.533	1.882E-80	716	0.424	0.432	P26928.pdb.gz	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
8	AFDB:F7FMS0	0.513	0.506	1.991E-80	739	0.411	0.405	F7FMS0.pdb.gz	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
9	AFDB:P00747	0.288	0.259	5.239E-71	810	0.375	0.337	P00747.pdb.gz	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
10	AFDB:P06868	0.288	0.264	1.148E-70	812	0.370	0.331	P06868.pdb.gz	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
11	PDB:4a5tS	0.282	0.270	6.093E-66	767	0.379	0.360	4a5tS.pdb.gz
12	PDB:4duuA	0.279	0.295	3.040E-61	682	0.368	0.393	4duuA.pdb.gz
13	PDB:5edmA	0.348	0.449	9.620E-31	550	0.191	0.253	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
14	PDB:6bjrA	0.369	0.454	8.769E-23	575	0.196	0.249	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
15	PDB:1a0lA	0.273	0.780	1.522E-20	244	0.113	0.336	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
16	PDB:1cgiE	0.273	0.783	5.524E-20	245	0.088	0.261	1cgiE.pdb.gz
17	PDB:6i44A	0.273	0.333	2.005E-19	594	0.170	0.209	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
18	PDB:2a31A	0.265	0.829	3.512E-19	223	0.098	0.318	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
19	PDB:2a7jA	0.279	0.810	4.395E-19	240	0.102	0.308	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
20	PDB:4bnrA	0.274	0.805	5.199E-19	237	0.085	0.262	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1REK1	0.0	676	712	0.449	0.459	F1REK1_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
2	F7FMS0	0.0	574	739	0.418	0.411	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
3	P14210	0.0	1521	728	1.000	1.000	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2
4	P17945	0.0	1359	728	0.902	0.902	HGF_RAT Hepatocyte growth factor OS=Rattus norvegicus OX=10116 GN=Hgf PE=1 SV=1
5	P26927	0.0	599	711	0.423	0.433	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
6	P26928	0.0	580	716	0.419	0.426	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
7	P70521	0.0	582	716	0.415	0.422	P70521_RAT Macrophage stimulating 1 (Hepatocyte growth factor-like) OS=Rattus norvegicus OX=10116 GN=Mst1 PE=2 SV=1
8	Q08048	0.0	1363	728	0.907	0.907	HGF_MOUSE Hepatocyte growth factor OS=Mus musculus OX=10090 GN=Hgf PE=1 SV=1
9	Q5RGG3	0.0	669	699	0.451	0.469	Q5RGG3_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
10	Q788Q2	0.0	631	405	0.398	0.716	Q788Q2_CHICK HGF protein ( SFprotein ) (Fragment) OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=1
11	Q90978	0.0	1133	726	0.728	0.730	Q90978_CHICK Hepatocyte growth factor OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=3
12	Q90ZN6	0.0	565	709	0.422	0.433	Q90ZN6_DANRE Hepatocyte growth factor-like 1 OS=Danio rerio OX=7955 GN=hgfl1 PE=2 SV=1
13	P20918	1.36e-151	462	812	0.350	0.314	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
14	P06868	4.02e-151	461	812	0.345	0.309	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
15	Q01177	5.52e-148	453	812	0.349	0.313	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
16	P00747	4.31e-140	433	810	0.341	0.306	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
17	P08519	1.75e-128	422	2040	0.349	0.125	APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens OX=9606 GN=LPA PE=1 SV=2
18	P19637	8.78e-47	177	559	0.183	0.238	TPA_RAT Tissue-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plat PE=2 SV=2
19	Q28198	1.36e-45	173	566	0.185	0.239	TPA_BOVIN Tissue-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAT PE=2 SV=1
20	P11214	6.49e-45	171	559	0.180	0.234	TPA_MOUSE Tissue-type plasminogen activator OS=Mus musculus OX=10090 GN=Plat PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	23	16.8	Domain of unknown function (DUF1986)
2	PF00811 Ependymin	46	15.6	Ependymin
3	PF00051 Kringle	7e-111	374.1	Kringle domain
4	PF00024 PAN_1	6e-07	40.6	PAN domain
5	PF00089 Trypsin	2.1e-47	173.4	Trypsin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317272	0.999	Hepatocyte growth factor receptor
2	9606.ENSP00000370542	0.997	Syndecan-1
3	9606.ENSP00000431418	0.995	High affinity nerve growth factor receptor
4	9606.ENSP00000263851	0.983	Interleukin-7
5	9606.ENSP00000385675	0.973	Interleukin-6
6	9606.ENSP00000398632	0.971	CD44 antigen
7	9606.ENSP00000215781	0.970	Oncostatin-M
8	9606.ENSP00000361405	0.970	Matrix metalloproteinase-9
9	9606.ENSP00000256078	0.968	GTPase KRas
10	9606.ENSP00000261769	0.967	Cadherin-1
11	9606.ENSP00000344456	0.967	Catenin beta-1
12	9606.ENSP00000412237	0.965	Interleukin-10
13	9606.ENSP00000342098	0.963	Kunitz-type protease inhibitor 1
14	9606.ENSP00000362680	0.963	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000376345	0.963	Growth factor receptor-bound protein 2
16	9606.ENSP00000219070	0.961	72 kDa type IV collagenase
17	9606.ENSP00000263025	0.960	Mitogen-activated protein kinase 3
18	9606.ENSP00000262995	0.959	GRB2-associated-binding protein 1
19	9606.ENSP00000407586	0.959	GTPase HRas
20	9606.ENSP00000421801	0.959	Hepatocyte growth factor activator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.998	catalytic activity, acting on a protein
GO:0030545	0.998	signaling receptor regulator activity
GO:0005102	0.998	signaling receptor binding
GO:0016787	0.997	hydrolase activity
GO:0140677	0.960	molecular function activator activity
GO:0008233	0.958	peptidase activity
GO:0048018	0.927	receptor ligand activity
GO:0019899	0.836	enzyme binding
GO:0008236	0.787	serine-type peptidase activity
GO:0042802	0.780	identical protein binding
GO:0042056	0.590	chemoattractant activity
GO:0004175	0.573	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0048523	0.993	negative regulation of cellular process
GO:0019222	0.991	regulation of metabolic process
GO:0050793	0.989	regulation of developmental process
GO:0048583	0.988	regulation of response to stimulus
GO:0048522	0.988	positive regulation of cellular process
GO:0048856	0.977	anatomical structure development
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0009987	0.966	cellular process
GO:0080090	0.956	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0031323	0.950	regulation of cellular metabolic process
GO:0010646	0.947	regulation of cell communication
GO:0023051	0.945	regulation of signaling
GO:0051174	0.941	regulation of phosphorus metabolic process
GO:0009966	0.930	regulation of signal transduction
GO:0022603	0.926	regulation of anatomical structure morphogenesis
GO:0050896	0.919	response to stimulus
GO:0010468	0.918	regulation of gene expression
GO:0042127	0.914	regulation of cell population proliferation
GO:0001932	0.909	regulation of protein phosphorylation
GO:0080134	0.889	regulation of response to stress
GO:0048513	0.888	animal organ development
GO:0051716	0.881	cellular response to stimulus
GO:0023052	0.873	signaling
GO:0007154	0.869	cell communication
GO:0009893	0.865	positive regulation of metabolic process
GO:0010941	0.862	regulation of cell death
GO:0007165	0.858	signal transduction
GO:0042327	0.857	positive regulation of phosphorylation
GO:0001934	0.853	positive regulation of protein phosphorylation
GO:0048584	0.831	positive regulation of response to stimulus
GO:0008284	0.817	positive regulation of cell population proliferation
GO:1902531	0.813	regulation of intracellular signal transduction
GO:0009892	0.811	negative regulation of metabolic process
GO:0010628	0.806	positive regulation of gene expression
GO:0043067	0.801	regulation of programmed cell death
GO:0051093	0.797	negative regulation of developmental process
GO:0042981	0.790	regulation of apoptotic process
GO:0043069	0.787	negative regulation of programmed cell death
GO:1902533	0.784	positive regulation of intracellular signal transduction
GO:0043066	0.781	negative regulation of apoptotic process
GO:0010605	0.779	negative regulation of macromolecule metabolic process
GO:0051239	0.761	regulation of multicellular organismal process
GO:0051240	0.748	positive regulation of multicellular organismal process
GO:0045595	0.729	regulation of cell differentiation
GO:0051094	0.724	positive regulation of developmental process
GO:0051128	0.677	regulation of cellular component organization
GO:0048585	0.677	negative regulation of response to stimulus
GO:0045596	0.663	negative regulation of cell differentiation
GO:0032501	0.652	multicellular organismal process
GO:0010629	0.648	negative regulation of gene expression
GO:2000026	0.624	regulation of multicellular organismal development
GO:0009968	0.609	negative regulation of signal transduction
GO:2001233	0.569	regulation of apoptotic signaling pathway
GO:0007166	0.562	cell surface receptor signaling pathway
GO:0065009	0.556	regulation of molecular function
GO:0007275	0.549	multicellular organism development
GO:0080135	0.523	regulation of cellular response to stress
GO:0008152	0.508	metabolic process
GO:0071704	0.460	organic substance metabolic process
GO:0042221	0.434	response to chemical
GO:0043408	0.426	regulation of MAPK cascade
GO:2000145	0.382	regulation of cell motility
GO:0007169	0.371	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032101	0.360	regulation of response to external stimulus
GO:0030334	0.347	regulation of cell migration
GO:0050790	0.340	regulation of catalytic activity
GO:0048731	0.337	system development
GO:0030335	0.331	positive regulation of cell migration
GO:0030154	0.330	cell differentiation
GO:0070887	0.325	cellular response to chemical stimulus
GO:0019219	0.320	regulation of nucleobase-containing compound metabolic process
GO:0051130	0.314	positive regulation of cellular component organization
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.888	extracellular space
GO:0043226	0.860	organelle
GO:0005622	0.855	intracellular anatomical structure
GO:0043227	0.841	membrane-bounded organelle
GO:0005737	0.821	cytoplasm
GO:0043231	0.774	intracellular membrane-bounded organelle
GO:0071944	0.356	cell periphery
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.997	Hydrolases.
EC:3.4.-.-	0.958	Acting on peptide bonds (peptidases).

[back to server]