StarFunc result for job id P14317

User Input

>input (486 residues)
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
GGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKA
KFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVY
EAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA
GAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPAN
YVKLLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14317	1.000	1.000	7.854E-77	486	1.000	1.000	P14317.pdb.gz	HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=3
2	AFDB:E7EVW7	0.146	0.155	7.476E-62	449	0.920	0.996	E7EVW7.pdb.gz	E7EVW7_HUMAN Hematopoietic cell-specific Lyn substrate 1 OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=1
3	AFDB:P49710	0.157	0.157	5.637E-58	486	0.842	0.842	P49710.pdb.gz	HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus OX=10090 GN=Hcls1 PE=1 SV=2
4	AFDB:Q01406	0.169	0.149	1.557E-35	563	0.486	0.419	Q01406.pdb.gz	SRC8_CHICK Src substrate protein p85 OS=Gallus gallus OX=9031 GN=CTTN1 PE=1 SV=1
5	AFDB:O96046	0.178	0.159	2.247E-35	559	0.475	0.413	O96046.pdb.gz	O96046_DROME Cortactin OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=2 SV=1
6	AFDB:A9P3U3	0.121	0.077	1.465E-9	774	0.204	0.128	A9P3U3.pdb.gz	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
7	AFDB:Q66IV2	0.119	0.116	9.751E-9	503	0.163	0.157	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
8	AFDB:Q8IZP0	0.113	0.108	7.336E-8	508	0.160	0.154	Q8IZP0.pdb.gz	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
9	AFDB:Q9NYB9	0.118	0.112	1.437E-7	513	0.171	0.162	Q9NYB9.pdb.gz	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
10	AFDB:E9PEZ7	0.118	0.126	3.384E-7	458	0.187	0.199	E9PEZ7.pdb.gz	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
11	PDB:2dybA	0.116	0.187	1.050E-5	298	0.039	0.064	2dybA.pdb.gz
12	PDB:3ehqA	0.110	0.284	1.516E-5	182	0.039	0.104	3ehqA.pdb.gz
13	PDB:1griA	0.120	0.270	3.158E-5	211	0.041	0.095	1griA.pdb.gz
14	PDB:4mt6A	0.102	0.127	9.494E-5	389	0.039	0.049	4mt6A.pdb.gz
15	PDB:3qwyA	0.111	0.310	2.102E-4	170	0.033	0.094	3qwyA.pdb.gz
16	PDB:1k9aB	0.113	0.124	2.235E-4	441	0.039	0.043	1k9aB.pdb.gz
17	PDB:6x5hA	0.106	0.111	4.949E-4	467	0.031	0.032	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
18	PDB:2h8hA	0.103	0.113	1.582E-3	445	0.033	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:2lqnA	0.112	0.175	1.582E-3	303	0.043	0.069	2lqnA.pdb.gz
20	PDB:1k0xA	0.106	0.442	2.742E-3	108	0.029	0.130	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EVW7	0.0	775	449	0.907	0.982	E7EVW7_HUMAN Hematopoietic cell-specific Lyn substrate 1 OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=1
2	P14317	0.0	984	486	1.000	1.000	HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=3
3	P49710	0.0	717	486	0.833	0.833	HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus OX=10090 GN=Hcls1 PE=1 SV=2
4	Q1RMR3	7.71e-124	374	538	0.467	0.422	Q1RMR3_BOVIN Cortactin OS=Bos taurus OX=9913 GN=CTTN PE=1 SV=1
5	O96046	3.71e-122	370	559	0.475	0.413	O96046_DROME Cortactin OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=2 SV=1
6	Q60598	5.46e-122	369	546	0.479	0.427	SRC8_MOUSE Src substrate cortactin OS=Mus musculus OX=10090 GN=Cttn PE=1 SV=2
7	Q9VDF4	1.62e-120	365	559	0.475	0.413	Q9VDF4_DROME Cortactin, isoform A OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=1 SV=1
8	Q01406	1.38e-106	330	563	0.300	0.259	SRC8_CHICK Src substrate protein p85 OS=Gallus gallus OX=9031 GN=CTTN1 PE=1 SV=1
9	Q14247	1.18e-105	327	550	0.305	0.269	SRC8_HUMAN Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2
10	Q66HL2	2.34e-105	325	509	0.302	0.289	SRC8_RAT Src substrate cortactin OS=Rattus norvegicus OX=10116 GN=Cttn PE=1 SV=1
11	H0Y5J4	3.51e-19	91.3	359	0.160	0.217	H0Y5J4_HUMAN Drebrin like (Fragment) OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
12	Q9UJU6	4.73e-19	91.7	430	0.160	0.181	DBNL_HUMAN Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
13	B4DDD6	1.01e-18	90.5	406	0.160	0.192	B4DDD6_HUMAN Drebrin like OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
14	H7C111	1.06e-18	84.7	138	0.130	0.457	H7C111_HUMAN Drebrin like (Fragment) OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1
15	Q62418	5.11e-18	88.6	436	0.158	0.177	DBNL_MOUSE Drebrin-like protein OS=Mus musculus OX=10090 GN=Dbnl PE=1 SV=2
16	Q9JHL4	1.61e-16	84.0	436	0.072	0.080	DBNL_RAT Drebrin-like protein OS=Rattus norvegicus OX=10116 GN=Dbnl PE=1 SV=1
17	Q9P7E8	7.39e-14	76.6	857	0.060	0.034	APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=app1 PE=2 SV=1
18	Q9VU84	3.02e-13	74.3	531	0.066	0.060	DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster OX=7227 GN=Abp1 PE=1 SV=1
19	Q91X43	1.25e-12	72.8	789	0.070	0.043	SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus OX=10090 GN=Sh3d19 PE=1 SV=2
20	A0A0U1RQE4	1.33e-11	69.7	1047	0.066	0.031	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02218 HS1_rep	2.9e-64	224.4	Repeat in HS1/Cortactin
2	PF00018 SH3_1	9.8e-13	58.8	SH3 domain
3	PF07653 SH3_2	2.3e-05	35.4	Variant SH3 domain
4	PF14604 SH3_9	1.1e-11	55.7	Variant SH3 domain
5	PF15754 SPESP1	7.1e+02	10.8	Sperm equatorial segment protein 1
6	PF15195 TMEM210	45	15.9	TMEM210 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320176

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428924	0.992	Tyrosine-protein kinase Lyn
2	9606.ENSP00000364907	0.975	Tyrosine-protein kinase SYK
3	9606.ENSP00000365891	0.962	Wiskott-Aldrich syndrome protein
4	9606.ENSP00000263238	0.933	Actin-related protein 3
5	9606.ENSP00000289902	0.927	High affinity immunoglobulin epsilon receptor subunit gamma
6	9606.ENSP00000367220	0.923	Actin-related protein 2
7	9606.ENSP00000278888	0.915	High affinity immunoglobulin epsilon receptor subunit beta
8	9606.ENSP00000357097	0.915	High affinity immunoglobulin epsilon receptor subunit alpha
9	9606.ENSP00000373905	0.886	Dynamin-2
10	9606.ENSP00000252071	0.885	Actin-related protein 3C
11	9606.ENSP00000256001	0.885	Actin-related protein 3B
12	9606.ENSP00000281537	0.878	Tight junction protein ZO-1
13	9606.ENSP00000295685	0.867	Actin-related protein 2/3 complex subunit 2
14	9606.ENSP00000362680	0.865	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000294742	0.861	Actin-related protein 2/3 complex subunit 5
16	9606.ENSP00000356705	0.859	Dynamin-3
17	9606.ENSP00000362014	0.859	Dynamin-1
18	9606.ENSP00000389631	0.859	Actin-related protein 2/3 complex subunit 1B
19	9606.ENSP00000253083	0.852	Huntingtin-interacting protein 1-related protein
20	9606.ENSP00000388169	0.843	Actin-related protein 2/3 complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.894	enzyme binding
GO:0140297	0.848	DNA-binding transcription factor binding
GO:0019900	0.830	kinase binding
GO:0019901	0.814	protein kinase binding
GO:0061629	0.813	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0050896	0.970	response to stimulus
GO:0048518	0.964	positive regulation of biological process
GO:0048522	0.945	positive regulation of cellular process
GO:0002684	0.914	positive regulation of immune system process
GO:0016043	0.886	cellular component organization
GO:1902107	0.885	positive regulation of leukocyte differentiation
GO:0051247	0.883	positive regulation of protein metabolic process
GO:0002761	0.880	regulation of myeloid leukocyte differentiation
GO:0048519	0.874	negative regulation of biological process
GO:0002763	0.873	positive regulation of myeloid leukocyte differentiation
GO:0032502	0.863	developmental process
GO:0019220	0.858	regulation of phosphate metabolic process
GO:0001932	0.851	regulation of protein phosphorylation
GO:0051716	0.847	cellular response to stimulus
GO:0033043	0.846	regulation of organelle organization
GO:0048856	0.843	anatomical structure development
GO:0048523	0.843	negative regulation of cellular process
GO:0045937	0.840	positive regulation of phosphate metabolic process
GO:0042327	0.833	positive regulation of phosphorylation
GO:0031401	0.821	positive regulation of protein modification process
GO:0010468	0.809	regulation of gene expression
GO:0032970	0.802	regulation of actin filament-based process
GO:0051130	0.801	positive regulation of cellular component organization
GO:0042221	0.793	response to chemical
GO:0001934	0.787	positive regulation of protein phosphorylation
GO:0032879	0.766	regulation of localization
GO:0031326	0.764	regulation of cellular biosynthetic process
GO:0019219	0.758	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.756	regulation of macromolecule biosynthetic process
GO:0007154	0.748	cell communication
GO:0030154	0.715	cell differentiation
GO:0048468	0.702	cell development
GO:0048583	0.689	regulation of response to stimulus
GO:0006355	0.689	regulation of DNA-templated transcription
GO:0009967	0.673	positive regulation of signal transduction
GO:0007165	0.664	signal transduction
GO:0043067	0.649	regulation of programmed cell death
GO:0051493	0.646	regulation of cytoskeleton organization
GO:0051049	0.635	regulation of transport
GO:0050730	0.614	regulation of peptidyl-tyrosine phosphorylation
GO:0050731	0.581	positive regulation of peptidyl-tyrosine phosphorylation
GO:0065008	0.576	regulation of biological quality
GO:0042981	0.569	regulation of apoptotic process
GO:0032956	0.538	regulation of actin cytoskeleton organization
GO:0002376	0.525	immune system process
GO:0043069	0.512	negative regulation of programmed cell death
GO:0009891	0.494	positive regulation of biosynthetic process
GO:0045935	0.491	positive regulation of nucleobase-containing compound metabolic process
GO:0043066	0.483	negative regulation of apoptotic process
GO:0031328	0.462	positive regulation of cellular biosynthetic process
GO:0060341	0.454	regulation of cellular localization
GO:1902903	0.448	regulation of supramolecular fiber organization
GO:0032501	0.444	multicellular organismal process
GO:0044087	0.426	regulation of cellular component biogenesis
GO:0045944	0.411	positive regulation of transcription by RNA polymerase II
GO:1902531	0.397	regulation of intracellular signal transduction
GO:0065009	0.393	regulation of molecular function
GO:0051495	0.372	positive regulation of cytoskeleton organization
GO:0110053	0.320	regulation of actin filament organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005886	1.000	plasma membrane
GO:0005829	0.999	cytosol
GO:0005634	0.994	nucleus
GO:0032991	0.985	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]