StarFunc result for job id P14373

User Input

>input (513 residues)
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1U9X8R9	0.647	0.647	3.727E-91	513	1.000	1.000	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
2	AFDB:A0A024RCR1	0.339	0.356	1.796E-47	488	0.363	0.381	A0A024RCR1.pdb.gz
3	AFDB:A0A024RCP5	0.347	0.344	2.014E-47	518	0.365	0.361	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
4	AFDB:Q62191	0.349	0.380	3.569E-47	470	0.339	0.370	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
5	AFDB:Q923T7	0.393	0.395	2.358E-46	510	0.396	0.398	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
6	AFDB:P19474	0.356	0.384	2.964E-46	475	0.355	0.383	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
7	AFDB:Q5NCC9	0.349	0.369	6.237E-46	485	0.357	0.377	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
8	AFDB:Q96F44	0.336	0.367	2.462E-45	468	0.374	0.410	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
9	AFDB:Q99PQ2	0.340	0.372	3.095E-45	467	0.357	0.392	Q99PQ2.pdb.gz	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
10	AFDB:Q9C029	0.370	0.371	6.512E-45	511	0.390	0.391	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
11	PDB:7y4sA	0.336	0.495	8.918E-21	343	0.162	0.242	7y4sA.pdb.gz
12	PDB:4b3nA	0.302	0.279	7.203E-18	557	0.119	0.110	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.231	0.652	1.048E-7	164	0.060	0.189	7ccbA.pdb.gz
14	PDB:4tn3B	0.298	0.405	3.291E-7	362	0.097	0.138	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
15	PDB:7z36B	0.280	0.313	5.832E-7	446	0.099	0.114	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:7nscA	0.249	0.436	4.511E-5	276	0.057	0.105	7nscA.pdb.gz
17	PDB:6swy1	0.198	0.188	6.005E-5	542	0.076	0.072	6swy1.pdb.gz
18	PDB:7nsba	0.225	0.205	3.539E-4	568	0.062	0.056	7nsba.pdb.gz
19	PDB:7u9tA	0.200	0.028	3.967E-4	4229	0.045	0.005	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7tdgA	0.183	0.025	5.281E-4	4134	0.041	0.005	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X8R9	0.0	1072	513	1.000	1.000	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
2	P14373	0.0	1072	513	1.000	1.000	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
3	Q62158	0.0	1063	513	0.988	0.988	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
4	F8W6Z2	2.60e-114	352	601	0.337	0.288	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
5	A0A024RCP5	5.07e-113	346	518	0.378	0.375	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
6	Q9HCM9	5.07e-113	346	518	0.378	0.375	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
7	O15553	2.23e-112	352	781	0.337	0.222	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
8	Q96F44	5.90e-110	337	468	0.382	0.419	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
9	Q99PQ2	1.63e-107	330	467	0.370	0.407	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
10	P19474	1.76e-107	330	475	0.363	0.392	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
11	Q923T7	2.13e-104	323	510	0.384	0.386	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
12	Q6AZZ1	4.05e-104	322	485	0.372	0.394	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
13	Q9C029	3.71e-103	320	511	0.380	0.382	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
14	Q9Y577	2.16e-94	296	477	0.366	0.394	TRI17_HUMAN E3 ubiquitin-protein ligase TRIM17 OS=Homo sapiens OX=9606 GN=TRIM17 PE=1 SV=1
15	Q5NCC9	2.49e-94	297	485	0.361	0.381	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
16	Q3U7K7	8.13e-93	292	462	0.337	0.374	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
17	Q62191	1.25e-92	292	470	0.337	0.368	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
18	O00635	3.01e-89	283	465	0.324	0.357	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
19	Q9UDY6	1.03e-84	271	481	0.324	0.345	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
20	A6NK02	7.10e-83	266	468	0.316	0.346	TRI75_HUMAN Tripartite motif-containing protein 75 OS=Homo sapiens OX=9606 GN=TRIM75 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	6.2e+02	11.7	Baculovirus immediate-early protein (IE-0)
2	PF13765 PRY	5.6e-20	82.0	SPRY-associated domain
3	PF00622 SPRY	9.1e-18	75.9	SPRY domain
4	PF00643 zf-B_box	3.3e-08	44.8	B-box zinc finger
5	PF00097 zf-C3HC4	4.6e-05	34.5	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	0.34	22.1	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.09	23.9	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	5.1e-06	37.8	zinc finger of C3HC4-type, RING
9	PF13639 zf-RING_2	0.43	22.3	Ring finger domain
10	PF14634 zf-RING_5	41	15.6	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	0.00025	32.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375560.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010381935.1	0.930	Ubiquitin carboxyl-terminal hydrolase 7 isoform X1
2	61622.XP_010377880.1	0.888	MAGE family member L2
3	61622.XP_010386100.1	0.738	Belongs to the ubiquitin-conjugating enzyme family.
4	61622.XP_010385198.1	0.699	Small ubiquitin-related modifier 1
5	61622.XP_010376465.1	0.691	ubiquitin-40S ribosomal protein S27a
6	61622.XP_010357050.1	0.672	Belongs to the MDM2/MDM4 family.
7	61622.XP_010377926.1	0.638	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
8	61622.XP_010354387.1	0.630	Conserved helix-loop-helix ubiquitous kinase
9	61622.XP_010381549.1	0.602	Promyelocytic leukemia
10	61622.XP_010352359.1	0.600	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
11	61622.XP_010380663.1	0.600	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
12	61622.XP_010366723.1	0.595	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 18137 ESTs, 162 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
13	61622.XP_010386044.1	0.595	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 2292 ESTs, 288 Proteins, and 87% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	61622.XP_010357545.1	0.594	Ubiquitin
15	61622.XP_010384959.1	0.594	ubiquitin-60S ribosomal protein L40 isoform X1
16	61622.XP_010384902.1	0.578	T-cell receptor-associated transmembrane adapter 1 isoform X1
17	61622.XP_010372826.1	0.567	Gamma-butyrobetaine hydroxylase 1
18	61622.XP_010363711.1	0.565	Zinc finger protein 692
19	61622.XP_010385219.1	0.555	Serine/threonine-protein kinase TBK1 isoform X1
20	61622.XP_010370292.1	0.546	Tripartite motif containing 33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.962	catalytic activity
GO:0016740	0.951	transferase activity
GO:0140096	0.948	catalytic activity, acting on a protein
GO:0019787	0.941	ubiquitin-like protein transferase activity
GO:0004842	0.874	ubiquitin-protein transferase activity
GO:0042802	0.653	identical protein binding
GO:1901363	0.332	heterocyclic compound binding
GO:0097159	0.332	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.977	primary metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0006950	0.966	response to stress
GO:0048518	0.941	positive regulation of biological process
GO:0048519	0.940	negative regulation of biological process
GO:0006807	0.934	nitrogen compound metabolic process
GO:0031323	0.933	regulation of cellular metabolic process
GO:0009987	0.922	cellular process
GO:0010468	0.921	regulation of gene expression
GO:0036211	0.912	protein modification process
GO:0002376	0.896	immune system process
GO:0006952	0.885	defense response
GO:0009889	0.885	regulation of biosynthetic process
GO:0048523	0.867	negative regulation of cellular process
GO:0019219	0.863	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.846	regulation of cellular biosynthetic process
GO:0010556	0.845	regulation of macromolecule biosynthetic process
GO:0051252	0.808	regulation of RNA metabolic process
GO:0048522	0.778	positive regulation of cellular process
GO:0070647	0.715	protein modification by small protein conjugation or removal
GO:0006355	0.706	regulation of DNA-templated transcription
GO:0051707	0.683	response to other organism
GO:0044237	0.592	cellular metabolic process
GO:0050792	0.573	regulation of viral process
GO:0009892	0.570	negative regulation of metabolic process
GO:0032446	0.569	protein modification by small protein conjugation
GO:0010605	0.552	negative regulation of macromolecule metabolic process
GO:0031324	0.531	negative regulation of cellular metabolic process
GO:0051172	0.528	negative regulation of nitrogen compound metabolic process
GO:0048583	0.512	regulation of response to stimulus
GO:0009893	0.463	positive regulation of metabolic process
GO:0098542	0.452	defense response to other organism
GO:0071840	0.435	cellular component organization or biogenesis
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0051246	0.421	regulation of protein metabolic process
GO:0006955	0.416	immune response
GO:0051128	0.412	regulation of cellular component organization
GO:0065009	0.411	regulation of molecular function
GO:0045087	0.393	innate immune response
GO:0016043	0.387	cellular component organization
GO:0023051	0.366	regulation of signaling
GO:0010646	0.366	regulation of cell communication
GO:0009966	0.360	regulation of signal transduction
GO:0016567	0.334	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005829	0.933	cytosol
GO:0005730	0.407	nucleolus
GO:0032991	0.327	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.951	Transferases.

[back to server]