StarFunc result for job id P14410

User Input

>input (1827 residues)
MARKKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEISDSTSTPATTRVTTNPSDS
GKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMT
TTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEF
TGPTVSDTLYDVKVAQNPFSIQVIRKSNGKTLFDTSIGPLVYSDQYLQISTRLPSDYIYG
IGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYILLGDTPEQVVQQYQQLVGLPAMPAYWNLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQDLHDHGQ
KYVIILDPAISIGRRANGTTYATYERGNTQHVWINESDGSTPIIGEVWPGLTVYPDFTNP
NCIDWWANECSIFHQEVQYDGLWIDMNEVSSFIQGSTKGCNVNKLNYPPFTPDILDKLMY
SKTICMDAVQNWGKQYDVHSLYGYSMAIATEQAVQKVFPNKRSFILTRSTFAGSGRHAAH
WLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPFSR
NHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKAHVFGETVARPVLHE
FYEDTNSWIEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYESGAKRPWRKQRVDM
YLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTAKGDFFWDDGETKDT
IQNGNYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDSVTEVRVAENNQPMN
AHSNFTYDASNQVLLIADLKLNLGRNFSVQWNQIFSENERFNCYPDADLATEQKCTQRGC
VWRTGSSLSKAPECYFPRQDNSYSVNSARYSSMGITADLQLNTANARIKLPSDPISTLRV
EVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVEIKENPFGIQIRRRS
SGRVIWDSWLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWNTWGMFTRDQPP
GYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYRTVGGILDFYMFLGP
TPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVRELYDAMVAANIPYDVQYTDI
DYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETKTYPAFERGQQNDVF
VKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTAEWWAREIVD
FYNEKMKFDGLWIDMNEPSSFVNGTTTNQCRNDELNYPPYFPELTKRTDGLHFRTICMEA
EQILSDGTSVLHYDVHNLYGWSQMKPTHDALQKTTGKRGIVISRSTYPTSGRWGGHWLGD
NYARWDNMDKSIIGMMEFSLFGMSYTGADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNI
ANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGTVIRPLLHEFFDEKP
TWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIGVRGQFQTFNASYDT
INLHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY
LSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNE
DTTNMILRIDLTTHNVTLEEPIEINWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5kzwA	0.453	0.967	0.000	850	0.204	0.438	5kzwA.pdb.gz	The structure of human GAA: structural basis of Pompe disease
2	AFDB:A0A0J9YVE6	0.514	0.773	0.000	1200	0.367	0.559	A0A0J9YVE6.pdb.gz	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
3	AFDB:F8VQM5	0.721	0.724	0.000	1818	0.777	0.781	F8VQM5.pdb.gz	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
4	AFDB:O43451	0.592	0.584	0.000	1857	0.592	0.582	O43451.pdb.gz	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
5	AFDB:P10253	0.459	0.873	0.000	952	0.209	0.401	P10253.pdb.gz	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
6	AFDB:P14410	1.000	1.000	0.000	1827	1.000	1.000	P14410.pdb.gz	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
7	AFDB:P23739	0.707	0.702	0.000	1841	0.748	0.742	P23739.pdb.gz	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
8	AFDB:P70699	0.460	0.874	0.000	953	0.206	0.395	P70699.pdb.gz	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
9	AFDB:Q2M2H8	0.496	0.363	0.000	2515	0.559	0.406	Q2M2H8.pdb.gz	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
10	AFDB:Q21750	0.446	0.838	6.795E-93	955	0.178	0.341	Q21750.pdb.gz	Q21750_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-2 PE=1 SV=3
11	AFDB:Q19004	0.445	0.858	2.453E-91	936	0.180	0.350	Q19004.pdb.gz	Q19004_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-1 PE=1 SV=2
12	PDB:5iefA	0.409	0.855	2.415E-70	858	0.128	0.273	5iefA.pdb.gz	Structures of mammalian ER alpha-glucosidase II capture the binding modes of broad-spectrum iminosugar antivirals.
13	PDB:5npbA	0.376	0.849	1.424E-53	780	0.087	0.204	5npbA.pdb.gz	1,6-Cyclophellitol Cyclosulfates: A New Class of Irreversible Glycosidase Inhibitor.
14	PDB:2f2hA	0.364	0.817	3.491E-44	773	0.080	0.189	2f2hA.pdb.gz	Expanding the Thioglycoligase Strategy to the Synthesis of alpha-linked Thioglycosides Allows Structural Investigation of the Parent Enzyme/Substrate Complex
15	PDB:5jovA	0.353	0.655	8.898E-44	949	0.092	0.177	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
16	PDB:6druA	0.295	0.708	2.687E-34	718	0.075	0.191	6druA.pdb.gz	Crystal Structure of alpha-Xylosidase fromAspergillus nigerin Complex with a Hydrolyzed Xyloglucan Product and New Insights in Accurately Predicting Substrate Specificities of GH31 Family Glycosidases.
17	PDB:5aedA	0.273	0.698	4.072E-34	674	0.061	0.165	5aedA.pdb.gz	Yihq is a Sulfoquinovosidase that Cleaves Sulfoquinovosyl Diacylglyceride Sulfolipids.
18	PDB:4fnsA	0.199	0.434	3.654E-14	718	0.043	0.110	4fnsA.pdb.gz	The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
19	PDB:2xn2A	0.202	0.438	1.340E-13	729	0.050	0.125	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
20	PDB:5m1iA	0.174	0.470	2.040E-10	539	0.038	0.128	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YVE6	0.0	1404	1200	0.368	0.560	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
2	A0A0J9YVJ0	0.0	1276	986	0.326	0.603	A0A0J9YVJ0_MOUSE Maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
3	A0A571BF69	0.0	1787	3616	0.485	0.245	A0A571BF69_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
4	B5THE2	0.0	2289	1827	0.593	0.593	B5THE2_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
5	B5THE3	0.0	3059	1818	0.778	0.782	B5THE3_MOUSE Sucrase-isomaltase OS=Mus musculus OX=10090 GN=Sis PE=2 SV=1
6	F8VQM5	0.0	3058	1818	0.778	0.782	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
7	O43451	0.0	1876	2753	0.505	0.335	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
8	P10253	0.0	634	952	0.196	0.377	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
9	P14410	0.0	3823	1827	1.000	1.000	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
10	P23739	0.0	2865	1841	0.748	0.743	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
11	P70699	0.0	652	953	0.196	0.376	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
12	Q2M2H8	0.0	2113	2515	0.562	0.408	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
13	Q6P7A9	0.0	646	953	0.194	0.371	LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1
14	Q6XK24	0.0	603	536	0.163	0.554	Q6XK24_MOUSE Membrane-bound maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=2 SV=1
15	Q19004	1.31e-172	550	936	0.178	0.348	Q19004_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-1 PE=1 SV=2
16	Q21750	1.10e-168	540	955	0.188	0.359	Q21750_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-2 PE=1 SV=3
17	Q9LYF8	2.48e-158	511	902	0.164	0.333	Q9LYF8_ARATH AT5g11720/T22P22_110 OS=Arabidopsis thaliana OX=3702 GN=AGLU1 PE=1 SV=1
18	Q9S7Y7	5.38e-149	486	915	0.161	0.321	XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=XYL1 PE=1 SV=1
19	F4J6T7	2.24e-147	479	868	0.163	0.343	XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=XYL2 PE=5 SV=1
20	O04931	3.40e-145	475	913	0.169	0.337	AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris OX=161934 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02816 Alpha_kinase	1.6e+02	13.8	Alpha-kinase family
2	PF13802 Gal_mutarotas_2	4.7e-10	51.0	Galactose mutarotase-like
3	PF01055 Glyco_hydro_31	9.4e-297	995.7	Glycosyl hydrolases family 31
4	PF16863 NtCtMGAM_N	1.1e-65	230.2	N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
5	PF00088 Trefoil	1.9e-13	61.3	Trefoil (P-type) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481450	0.977	Pancreatic alpha-amylase
2	9606.ENSP00000218516	0.961	Galactosidase alpha
3	9606.ENSP00000330484	0.959	Belongs to the glycosyl hydrolase 13 family
4	9606.ENSP00000354610	0.951	Amylase, alpha 2B
5	9606.ENSP00000326227	0.925	Neutral alpha-glucosidase C
6	9606.ENSP00000260599	0.912	Ketohexokinase
7	9606.ENSP00000346643	0.909	Putative hexokinase HKDC1
8	9606.ENSP00000305692	0.907	Lysosomal alpha-glucosidase
9	9606.ENSP00000447378	0.907	Maltase-glucoamylase, intestinal
10	9606.ENSP00000402103	0.905	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
11	9606.ENSP00000290573	0.904	Hexokinase-2
12	9606.ENSP00000292432	0.903	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
13	9606.ENSP00000447431	0.903	Probable maltase-glucoamylase 2
14	9606.ENSP00000353731	0.881	Dipeptidyl peptidase 4
15	9606.ENSP00000380432	0.860	Insulin
16	9606.ENSP00000387662	0.830	Glucagon
17	9606.ENSP00000306920	0.826	Beta-galactosidase
18	9606.ENSP00000266086	0.808	Solute carrier family 5 member 4
19	9606.ENSP00000327943	0.807	Sodium/glucose cotransporter 2
20	9606.ENSP00000233616	0.772	Mannosyl-oligosaccharide glucosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0090599	1.000	alpha-glucosidase activity
GO:0004564	0.999	beta-fructofuranosidase activity
GO:0004558	0.991	alpha-1,4-glucosidase activity
GO:0005488	0.796	binding
GO:0005515	0.730	protein binding
GO:0016740	0.329	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0016052	0.973	carbohydrate catabolic process
GO:0044275	0.946	cellular carbohydrate catabolic process
GO:0009311	0.817	oligosaccharide metabolic process
GO:0009313	0.787	oligosaccharide catabolic process
GO:0005984	0.779	disaccharide metabolic process
GO:0046352	0.717	disaccharide catabolic process
GO:0032501	0.632	multicellular organismal process
GO:0043170	0.449	macromolecule metabolic process
GO:0050896	0.415	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005903	0.977	brush border
GO:0005576	0.966	extracellular region
GO:0012505	0.963	endomembrane system
GO:0005737	0.948	cytoplasm
GO:0043227	0.946	membrane-bounded organelle
GO:0043231	0.894	intracellular membrane-bounded organelle
GO:0071944	0.875	cell periphery
GO:0005886	0.856	plasma membrane
GO:0031982	0.845	vesicle
GO:0005615	0.747	extracellular space
GO:1903561	0.595	extracellular vesicle
GO:0070062	0.501	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.20	1.000	alpha-glucosidase.
EC:3.2.1.26	0.999	beta-fructofuranosidase.
EC:2.-.-.-	0.329	Transferases.

[back to server]