StarFunc result for job id P14415

User Input

>input (290 residues)
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13638	0.997	0.997	2.664E-64	290	0.972	0.972	P13638.pdb.gz	AT1B2_RAT Sodium/potassium-transporting ATPase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Atp1b2 PE=1 SV=1
2	AFDB:Q90Z34	0.929	0.923	1.670E-43	292	0.559	0.555	Q90Z34.pdb.gz	Q90Z34_DANRE Sodium/potassium-transporting ATPase subunit beta OS=Danio rerio OX=7955 GN=cb712 PE=1 SV=1
3	AFDB:Q9UN42	0.913	0.747	1.537E-39	357	0.400	0.325	Q9UN42.pdb.gz	AT1B4_HUMAN Protein ATP1B4 OS=Homo sapiens OX=9606 GN=ATP1B4 PE=1 SV=1
4	AFDB:Q99ME6	0.903	0.741	9.519E-38	356	0.379	0.309	Q99ME6.pdb.gz	AT1B4_MOUSE Protein ATP1B4 OS=Mus musculus OX=10090 GN=Atp1b4 PE=1 SV=1
5	AFDB:P54709	0.889	0.923	5.148E-37	279	0.455	0.473	P54709.pdb.gz	AT1B3_HUMAN Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1
6	AFDB:P18434	0.914	0.914	1.315E-36	290	0.400	0.400	P18434.pdb.gz	ATP4B_PIG Potassium-transporting ATPase subunit beta OS=Sus scrofa OX=9823 GN=ATP4B PE=1 SV=1
7	AFDB:Q63377	0.900	0.934	1.315E-36	279	0.455	0.473	Q63377.pdb.gz	AT1B3_RAT Sodium/potassium-transporting ATPase subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Atp1b3 PE=1 SV=1
8	AFDB:P51164	0.896	0.893	3.155E-36	291	0.390	0.388	P51164.pdb.gz	ATP4B_HUMAN Potassium-transporting ATPase subunit beta OS=Homo sapiens OX=9606 GN=ATP4B PE=1 SV=1
9	AFDB:P18597	0.902	0.899	4.052E-36	291	0.397	0.395	P18597.pdb.gz	ATP4B_RABIT Potassium-transporting ATPase subunit beta OS=Oryctolagus cuniculus OX=9986 GN=ATP4B PE=1 SV=1
10	AFDB:P18598	0.902	0.890	6.276E-36	294	0.386	0.381	P18598.pdb.gz	ATP4B_RAT Potassium-transporting ATPase subunit beta OS=Rattus norvegicus OX=10116 GN=Atp4b PE=2 SV=3
11	PDB:6jxkB	0.804	0.855	1.532E-30	271	0.362	0.387	6jxkB.pdb.gz	A single K + -binding site in the crystal structure of the gastric proton pump.
12	PDB:7x20B	0.805	0.810	5.406E-29	288	0.372	0.375	7x20B.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
13	PDB:3wguB	0.839	0.805	3.348E-27	303	0.400	0.383	3wguB.pdb.gz	Crystal structure of a Na1-bound Na1,K1-ATPase preceding the E1P state
14	PDB:2xzbB	0.538	0.876	1.111E-13	175	0.238	0.394	2xzbB.pdb.gz
15	PDB:5dfkA	0.201	0.297	7.483E-4	185	0.031	0.049	5dfkA.pdb.gz
16	PDB:1rowA	0.217	0.483	1.023E-3	107	0.048	0.131	1rowA.pdb.gz
17	PDB:4b0mM	0.229	0.297	1.089E-3	212	0.076	0.104	4b0mM.pdb.gz
18	PDB:2mspA	0.189	0.357	2.781E-3	124	0.059	0.137	2mspA.pdb.gz
19	PDB:3dpaA	0.230	0.292	4.586E-3	218	0.038	0.050	3dpaA.pdb.gz
20	PDB:4aq1A	0.209	0.098	4.586E-3	721	0.059	0.024	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13638	0.0	600	290	0.972	0.972	AT1B2_RAT Sodium/potassium-transporting ATPase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Atp1b2 PE=1 SV=1
2	P14231	0.0	598	290	0.972	0.972	AT1B2_MOUSE Sodium/potassium-transporting ATPase subunit beta-2 OS=Mus musculus OX=10090 GN=Atp1b2 PE=1 SV=2
3	P14415	0.0	612	290	1.000	1.000	AT1B2_HUMAN Sodium/potassium-transporting ATPase subunit beta-2 OS=Homo sapiens OX=9606 GN=ATP1B2 PE=1 SV=3
4	Q90Z34	6.81e-116	337	292	0.555	0.551	Q90Z34_DANRE Sodium/potassium-transporting ATPase subunit beta OS=Danio rerio OX=7955 GN=cb712 PE=1 SV=1
5	Q63377	4.87e-84	255	279	0.479	0.498	AT1B3_RAT Sodium/potassium-transporting ATPase subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Atp1b3 PE=1 SV=1
6	P54709	1.54e-83	254	279	0.469	0.487	AT1B3_HUMAN Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1
7	P97370	2.67e-78	241	278	0.452	0.471	AT1B3_MOUSE Sodium/potassium-transporting ATPase subunit beta-3 OS=Mus musculus OX=10090 GN=Atp1b3 PE=1 SV=1
8	Q9UN42	3.03e-77	241	357	0.400	0.325	AT1B4_HUMAN Protein ATP1B4 OS=Homo sapiens OX=9606 GN=ATP1B4 PE=1 SV=1
9	Q9BDK6	6.47e-74	232	355	0.393	0.321	AT1B4_PIG Protein ATP1B4 OS=Sus scrofa OX=9823 GN=ATP1B4 PE=1 SV=1
10	P51164	3.92e-73	228	291	0.393	0.392	ATP4B_HUMAN Potassium-transporting ATPase subunit beta OS=Homo sapiens OX=9606 GN=ATP4B PE=1 SV=1
11	P18434	1.47e-72	226	290	0.403	0.403	ATP4B_PIG Potassium-transporting ATPase subunit beta OS=Sus scrofa OX=9823 GN=ATP4B PE=1 SV=1
12	Q9R193	4.92e-72	227	356	0.379	0.309	AT1B4_RAT Protein ATP1B4 OS=Rattus norvegicus OX=10116 GN=Atp1b4 PE=1 SV=1
13	Q99ME6	7.66e-72	227	356	0.379	0.309	AT1B4_MOUSE Protein ATP1B4 OS=Mus musculus OX=10090 GN=Atp1b4 PE=1 SV=1
14	P18597	8.08e-72	224	291	0.393	0.392	ATP4B_RABIT Potassium-transporting ATPase subunit beta OS=Oryctolagus cuniculus OX=9986 GN=ATP4B PE=1 SV=1
15	P18598	2.04e-71	224	294	0.397	0.391	ATP4B_RAT Potassium-transporting ATPase subunit beta OS=Rattus norvegicus OX=10116 GN=Atp4b PE=2 SV=3
16	P14094	2.73e-68	216	304	0.421	0.401	AT1B1_MOUSE Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1
17	Q9TT37	2.77e-68	216	303	0.414	0.396	AT1B1_RABIT Sodium/potassium-transporting ATPase subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=ATP1B1 PE=1 SV=1
18	P07340	4.70e-68	215	304	0.414	0.395	AT1B1_RAT Sodium/potassium-transporting ATPase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Atp1b1 PE=1 SV=1
19	P05027	7.50e-68	215	303	0.410	0.393	AT1B1_PIG Sodium/potassium-transporting ATPase subunit beta-1 OS=Sus scrofa OX=9823 GN=ATP1B1 PE=1 SV=2
20	P05026	2.58e-67	213	303	0.407	0.389	AT1B1_HUMAN Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00287 Na_K-ATPase	1.6e-104	360.7	Sodium / potassium ATPase beta chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369320	0.974	Retinoschisin
2	9606.ENSP00000354490	0.971	Sodium/potassium-transporting ATPase subunit alpha-2
3	9606.ENSP00000445306	0.969	Sodium/potassium-transporting ATPase subunit alpha-1
4	9606.ENSP00000444688	0.958	Sodium/potassium-transporting ATPase subunit alpha-3
5	9606.ENSP00000357060	0.949	Sodium/potassium-transporting ATPase subunit alpha-4
6	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
7	9606.ENSP00000292079	0.922	Sodium/potassium-transporting ATPase subunit gamma
8	9606.ENSP00000356790	0.893	Sodium/potassium-transporting ATPase subunit beta-1
9	9606.ENSP00000481244	0.881	Phospholemman
10	9606.ENSP00000218548	0.838	Potassium-transporting ATPase alpha chain 2
11	9606.ENSP00000440045	0.821	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
12	9606.ENSP00000218008	0.814	Protein ATP1B4
13	9606.ENSP00000286371	0.812	Sodium/potassium-transporting ATPase subunit beta-3
14	9606.ENSP00000263980	0.775	Sodium/hydrogen exchanger 1
15	9606.ENSP00000333769	0.771	Basigin
16	9606.ENSP00000306372	0.767	Zinc finger protein 3
17	9606.ENSP00000297504	0.757	ATP-binding cassette sub-family B member 8, mitochondrial
18	9606.ENSP00000463784	0.729	Component of the large ribosomal subunit.
19	9606.ENSP00000260645	0.728	ATP-binding cassette sub-family G member 5
20	9606.ENSP00000272286	0.728	ATP-binding cassette sub-family G member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0060090	0.993	molecular adaptor activity
GO:0019899	0.992	enzyme binding
GO:0098772	0.991	molecular function regulator activity
GO:0060590	0.980	ATPase regulator activity
GO:0140677	0.972	molecular function activator activity
GO:0022857	0.972	transmembrane transporter activity
GO:0015318	0.933	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.922	monoatomic ion transmembrane transporter activity
GO:0022890	0.904	inorganic cation transmembrane transporter activity
GO:1901702	0.895	salt transmembrane transporter activity
GO:0008324	0.885	monoatomic cation transmembrane transporter activity
GO:0046873	0.879	metal ion transmembrane transporter activity
GO:0022804	0.875	active transmembrane transporter activity
GO:0001671	0.860	ATPase activator activity
GO:0051117	0.838	ATPase binding
GO:0030674	0.823	protein-macromolecule adaptor activity
GO:0042626	0.814	ATPase-coupled transmembrane transporter activity
GO:0022853	0.808	active monoatomic ion transmembrane transporter activity
GO:0015079	0.769	potassium ion transmembrane transporter activity
GO:0019829	0.766	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0015662	0.764	P-type ion transporter activity
GO:0008556	0.739	P-type potassium transmembrane transporter activity
GO:0015081	0.631	sodium ion transmembrane transporter activity
GO:0046983	0.580	protein dimerization activity
GO:0046982	0.573	protein heterodimerization activity
GO:0008554	0.559	P-type sodium transporter activity
GO:0005391	0.550	P-type sodium:potassium-exchanging transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0006810	0.985	transport
GO:0010959	0.985	regulation of metal ion transport
GO:1904062	0.979	regulation of monoatomic cation transmembrane transport
GO:0043266	0.977	regulation of potassium ion transport
GO:0098662	0.975	inorganic cation transmembrane transport
GO:0032411	0.975	positive regulation of transporter activity
GO:0030001	0.974	metal ion transport
GO:0032412	0.970	regulation of monoatomic ion transmembrane transporter activity
GO:0042592	0.966	homeostatic process
GO:0099587	0.965	inorganic ion import across plasma membrane
GO:0098655	0.961	monoatomic cation transmembrane transport
GO:0098659	0.960	inorganic cation import across plasma membrane
GO:0065008	0.958	regulation of biological quality
GO:0006813	0.953	potassium ion transport
GO:0098771	0.945	inorganic ion homeostasis
GO:1902305	0.945	regulation of sodium ion transmembrane transport
GO:1901379	0.945	regulation of potassium ion transmembrane transport
GO:1904064	0.945	positive regulation of cation transmembrane transport
GO:1902307	0.938	positive regulation of sodium ion transmembrane transport
GO:1901018	0.935	positive regulation of potassium ion transmembrane transporter activity
GO:0035725	0.911	sodium ion transmembrane transport
GO:0071805	0.893	potassium ion transmembrane transport
GO:0042391	0.886	regulation of membrane potential
GO:0061337	0.883	cardiac conduction
GO:0019725	0.877	cellular homeostasis
GO:0032501	0.876	multicellular organismal process
GO:0050801	0.873	monoatomic ion homeostasis
GO:0055080	0.860	monoatomic cation homeostasis
GO:0043462	0.854	regulation of ATP-dependent activity
GO:0030003	0.847	intracellular monoatomic cation homeostasis
GO:0007154	0.836	cell communication
GO:0140115	0.831	export across plasma membrane
GO:0055078	0.811	sodium ion homeostasis
GO:0055075	0.792	potassium ion homeostasis
GO:0050821	0.775	protein stabilization
GO:0032781	0.766	positive regulation of ATP-dependent activity
GO:0048856	0.764	anatomical structure development
GO:0007275	0.682	multicellular organism development
GO:2000649	0.632	regulation of sodium ion transmembrane transporter activity
GO:0048731	0.612	system development
GO:2000651	0.602	positive regulation of sodium ion transmembrane transporter activity
GO:0050896	0.578	response to stimulus
GO:1903406	0.575	regulation of P-type sodium:potassium-exchanging transporter activity
GO:0048513	0.388	animal organ development
GO:0051716	0.367	cellular response to stimulus
GO:0023052	0.345	signaling
GO:0071840	0.339	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902495	0.997	transmembrane transporter complex
GO:0098797	0.997	plasma membrane protein complex
GO:0045177	0.987	apical part of cell
GO:0005890	0.986	sodium:potassium-exchanging ATPase complex
GO:0098590	0.950	plasma membrane region
GO:0016324	0.884	apical plasma membrane
GO:0005622	0.790	intracellular anatomical structure
GO:0005737	0.759	cytoplasm
GO:0043229	0.702	intracellular organelle
GO:0043227	0.652	membrane-bounded organelle
GO:0120025	0.564	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.814	Translocases.
RHEA:29463	0.769	K(+)(in) = K(+)(out)
RHEA:16777	0.739	ATP + H2O + K(+)(out) = ADP + H(+) + K(+)(in) + phosphate
EC:7.2.2.6	0.739	P-type K(+) transporter.
RHEA:34963	0.631	Na(+)(in) = Na(+)(out)
RHEA:14633	0.559	ATP + H2O + Na(+)(in) = ADP + H(+) + Na(+)(out) + phosphate
EC:7.2.2.3	0.559	P-type Na(+) transporter.
RHEA:18353	0.550	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	0.550	Na(+)/K(+)-exchanging ATPase.

[back to server]