StarFunc result for job id P14416

User Input

>input (443 residues)
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20288	0.713	0.711	1.306E-49	444	0.966	0.964	P20288.pdb.gz	DRD2_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=2 SV=1
2	AFDB:G3MWM5	0.690	0.737	6.570E-47	414	0.903	0.966	G3MWM5.pdb.gz	G3MWM5_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=3 SV=1
3	AFDB:A9YZQ5	0.709	0.719	1.820E-41	437	0.799	0.810	A9YZQ5.pdb.gz	A9YZQ5_CHICK Dopamine receptor 2 protein transcript variant 1 OS=Gallus gallus OX=9031 GN=DRD2 PE=2 SV=1
4	AFDB:P35462	0.641	0.707	1.113E-30	400	0.506	0.560	P35462.pdb.gz	DRD3_HUMAN D(3) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD3 PE=1 SV=3
5	AFDB:P19020	0.648	0.644	3.203E-29	446	0.521	0.518	P19020.pdb.gz	DRD3_RAT D(3) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd3 PE=1 SV=1
6	PDB:7jvrR	0.572	0.923	2.193E-27	269	0.605	0.996	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
7	PDB:6cm4A	0.565	0.591	2.465E-25	423	0.614	0.643	6cm4A.pdb.gz	Structure of the D2 dopamine receptor bound to the atypical antipsychotic drug risperidone.
8	AFDB:Q8IS44	0.628	0.313	1.654E-24	905	0.391	0.191	Q8IS44.pdb.gz	DRD2L_DROME Dopamine D2-like receptor OS=Drosophila melanogaster OX=7227 GN=Dop2R PE=2 SV=2
9	AFDB:A0A060X727	0.632	0.719	1.113E-23	388	0.314	0.358	A0A060X727.pdb.gz	A0A060X727_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020782001 PE=3 SV=1
10	AFDB:A0A0R4IR92	0.594	0.688	6.252E-23	380	0.339	0.395	A0A0R4IR92.pdb.gz	A0A0R4IR92_DANRE D(4) dopamine receptor OS=Danio rerio OX=7955 GN=zgc:158147 PE=3 SV=1
11	PDB:3pblA	0.574	0.588	8.622E-23	432	0.463	0.475	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
12	AFDB:P21917	0.580	0.612	1.128E-22	419	0.350	0.370	P21917.pdb.gz	DRD4_HUMAN D(4) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD4 PE=1 SV=3
13	AFDB:Q9VEG1	0.627	0.446	3.354E-22	631	0.341	0.239	Q9VEG1.pdb.gz	Q9VEG1_DROME Tyramine receptor OS=Drosophila melanogaster OX=7227 GN=TyrR PE=2 SV=1
14	PDB:7cmuR	0.560	0.897	4.421E-22	272	0.447	0.728	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
15	PDB:7e32R	0.538	0.819	1.118E-16	285	0.257	0.400	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
16	PDB:7e2xR	0.549	0.859	2.420E-16	278	0.244	0.388	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
17	PDB:6iblA	0.532	0.590	5.003E-16	397	0.257	0.287	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
18	PDB:7xt8R	0.519	0.766	8.244E-16	294	0.246	0.371	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
19	PDB:7jvqR	0.550	0.831	1.186E-15	286	0.260	0.402	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:5d5aA	0.547	0.549	6.965E-15	442	0.257	0.258	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A077K956	0.0	720	437	0.799	0.810	A0A077K956_CHICK Dopamine receptor D2 OS=Gallus gallus OX=9031 GN=DRD2 PE=3 SV=1
2	A9YZQ5	0.0	721	437	0.799	0.810	A9YZQ5_CHICK Dopamine receptor 2 protein transcript variant 1 OS=Gallus gallus OX=9031 GN=DRD2 PE=2 SV=1
3	F1N4I3	0.0	892	443	0.968	0.968	F1N4I3_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=3 SV=2
4	G3MWM5	0.0	815	414	0.903	0.966	G3MWM5_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=3 SV=1
5	O73810	0.0	678	436	0.786	0.798	DRD2_MELGA D(2) dopamine receptor OS=Meleagris gallopavo OX=9103 GN=DRD2 PE=2 SV=1
6	P14416	0.0	920	443	1.000	1.000	DRD2_HUMAN D(2) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD2 PE=1 SV=2
7	P20288	0.0	884	444	0.966	0.964	DRD2_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=2 SV=1
8	P61168	0.0	862	444	0.957	0.955	DRD2_MOUSE D(2) dopamine receptor OS=Mus musculus OX=10090 GN=Drd2 PE=1 SV=2
9	P61169	0.0	864	444	0.959	0.957	DRD2_RAT D(2) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd2 PE=1 SV=1
10	H0YPR8	8.31e-142	416	473	0.485	0.455	H0YPR8_TAEGU Dopamine receptor D2 OS=Taeniopygia guttata OX=59729 GN=DRD2 PE=3 SV=2
11	P19020	2.62e-136	400	446	0.517	0.513	DRD3_RAT D(3) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd3 PE=1 SV=1
12	P30728	3.07e-134	395	446	0.517	0.513	DRD3_MOUSE D(3) dopamine receptor OS=Mus musculus OX=10090 GN=Drd3 PE=2 SV=1
13	P35462	1.71e-133	392	400	0.515	0.570	DRD3_HUMAN D(3) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD3 PE=1 SV=3
14	P22909	9.01e-77	248	465	0.343	0.327	ADA2A_RAT Alpha-2A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2a PE=1 SV=3
15	A0A060YRM0	8.02e-71	231	395	0.350	0.392	A0A060YRM0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023164001 PE=3 SV=1
16	P18871	1.03e-70	233	465	0.348	0.331	ADA2A_PIG Alpha-2A adrenergic receptor OS=Sus scrofa OX=9823 GN=ADRA2A PE=1 SV=2
17	A0A060W6G8	1.13e-70	230	390	0.318	0.362	A0A060W6G8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00082532001 PE=3 SV=1
18	Q90WY6	6.70e-69	227	432	0.334	0.343	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
19	Q01338	7.69e-67	222	465	0.330	0.314	ADA2A_MOUSE Alpha-2A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2a PE=1 SV=2
20	Q8JG69	2.16e-66	220	415	0.321	0.342	AA2DB_DANRE Alpha-2Db adrenergic receptor OS=Danio rerio OX=7955 GN=adra2db PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	7.5e-84	292.7	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.27	22.6	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	5.1e-14	63.8	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	0.3	22.0	Serpentine type 7TM GPCR chemoreceptor Srv
5	PF09972 DUF2207	13	16.0	Predicted membrane protein (DUF2207)
6	PF12713 DUF3806	2.2e+02	13.0	Domain of unknown function (DUF3806)
7	PF02009 RIFIN	3e+02	12.7	Rifin
8	PF17410 Stevor	6.6e+02	11.2	Subtelomeric Variable Open Reading frame

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354859

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361475	0.999	Neuronal calcium sensor 1
2	9606.ENSP00000358513	0.998	Cannabinoid receptor 1
3	9606.ENSP00000403701	0.998	Beta-arrestin-2
4	9606.ENSP00000270349	0.997	Sodium-dependent dopamine transporter
5	9606.ENSP00000477455	0.988	Glutamate receptor ionotropic, NMDA 2B
6	9606.ENSP00000312262	0.985	Beta-adrenergic receptor kinase 1
7	9606.ENSP00000277010	0.983	Sigma non-opioid intracellular receptor 1
8	9606.ENSP00000355593	0.980	Disrupted in schizophrenia 1 protein
9	9606.ENSP00000386444	0.952	S-arrestin
10	9606.ENSP00000324270	0.951	Oxytocin receptor
11	9606.ENSP00000354511	0.940	Catechol O-methyltransferase
12	9606.ENSP00000306678	0.938	Ankyrin repeat and kinase domain containing 1
13	9606.ENSP00000312999	0.924	Guanine nucleotide-binding protein G(i) subunit alpha-2
14	9606.ENSP00000287641	0.915	Somatostatin
15	9606.ENSP00000343027	0.913	Guanine nucleotide-binding protein G(i) subunit alpha-1
16	9606.ENSP00000328088	0.899	PRKC apoptosis WT1 regulator protein
17	9606.ENSP00000335074	0.898	Appetite-regulating hormone
18	9606.ENSP00000358867	0.898	Guanine nucleotide-binding protein G(k) subunit alpha
19	9606.ENSP00000306138	0.885	Metabotropic glutamate receptor 5
20	9606.ENSP00000376753	0.874	PDZ domain-containing protein GIPC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0004952	1.000	dopamine neurotransmitter receptor activity
GO:0005488	0.998	binding
GO:0005515	0.994	protein binding
GO:0008227	0.934	G protein-coupled amine receptor activity
GO:0042802	0.397	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051049	0.978	regulation of transport
GO:0048523	0.975	negative regulation of cellular process
GO:0090276	0.973	regulation of peptide hormone secretion
GO:0050896	0.970	response to stimulus
GO:0009987	0.970	cellular process
GO:0050709	0.970	negative regulation of protein secretion
GO:0051239	0.966	regulation of multicellular organismal process
GO:0002792	0.952	negative regulation of peptide secretion
GO:0046888	0.952	negative regulation of hormone secretion
GO:0048518	0.937	positive regulation of biological process
GO:0090278	0.922	negative regulation of peptide hormone secretion
GO:0007186	0.919	G protein-coupled receptor signaling pathway
GO:0032501	0.895	multicellular organismal process
GO:0034103	0.882	regulation of tissue remodeling
GO:1903350	0.859	response to dopamine
GO:1903351	0.853	cellular response to dopamine
GO:0010959	0.765	regulation of metal ion transport
GO:0034765	0.759	regulation of monoatomic ion transmembrane transport
GO:1903169	0.732	regulation of calcium ion transmembrane transport
GO:0048522	0.698	positive regulation of cellular process
GO:0034763	0.685	negative regulation of transmembrane transport
GO:0007188	0.673	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0050878	0.670	regulation of body fluid levels
GO:1903170	0.653	negative regulation of calcium ion transmembrane transport
GO:0007212	0.647	dopamine receptor signaling pathway
GO:0007610	0.523	behavior
GO:0051241	0.512	negative regulation of multicellular organismal process
GO:0050793	0.509	regulation of developmental process
GO:2000026	0.496	regulation of multicellular organismal development
GO:0051240	0.493	positive regulation of multicellular organismal process
GO:0051093	0.436	negative regulation of developmental process
GO:0008152	0.372	metabolic process
GO:0071704	0.363	organic substance metabolic process
GO:0044237	0.355	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.813	intracellular anatomical structure
GO:0043226	0.765	organelle
GO:0043227	0.729	membrane-bounded organelle
GO:0005737	0.672	cytoplasm
GO:0043229	0.615	intracellular organelle
GO:0043231	0.603	intracellular membrane-bounded organelle
GO:0120025	0.521	plasma membrane bounded cell projection
GO:0098590	0.512	plasma membrane region
GO:0030054	0.362	cell junction
GO:0031982	0.346	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]