StarFunc result for job id P14543

User Input

>input (1247 residues)
MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELS
GALRFYDRSDIDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLAT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGI
DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
PSRIYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEEKILRYALSNSIGPV
REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
PSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10493	0.370	0.370	0.000	1245	0.852	0.853	P10493.pdb.gz	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
2	AFDB:P14543	1.000	1.000	0.000	1247	1.000	1.000	P14543.pdb.gz	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
3	AFDB:Q8IV28	0.260	0.329	1.760E-98	969	0.306	0.393	Q8IV28.pdb.gz	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
4	AFDB:C7FZU4	0.284	0.283	4.640E-89	1248	0.271	0.271	C7FZU4.pdb.gz	C7FZU4_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
5	AFDB:Q93791	0.256	0.212	2.902E-84	1584	0.288	0.227	Q93791.pdb.gz	Q93791_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=2
6	AFDB:P01132	0.205	0.210	1.176E-31	1217	0.115	0.118	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
7	AFDB:O75096	0.235	0.156	1.581E-31	1905	0.157	0.103	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
8	AFDB:A0A2R8PYI8	0.235	0.300	6.286E-31	968	0.142	0.183	A0A2R8PYI8.pdb.gz	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
9	AFDB:F1M443	0.225	0.370	1.651E-28	752	0.111	0.184	F1M443.pdb.gz	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
10	AFDB:A0A140LH43	0.222	0.233	8.403E-28	1190	0.102	0.107	A0A140LH43.pdb.gz
11	PDB:6nqjA	0.144	0.642	3.647E-12	224	0.022	0.121	6nqjA.pdb.gz
12	PDB:4xbiA	0.144	0.429	1.401E-10	376	0.026	0.085	4xbiA.pdb.gz
13	PDB:4pfeA	0.140	0.449	2.659E-10	342	0.035	0.129	4pfeA.pdb.gz
14	PDB:5fguA	0.141	0.331	3.755E-10	494	0.041	0.103	5fguA.pdb.gz
15	PDB:4z4kA	0.141	0.548	4.144E-10	282	0.027	0.121	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
16	PDB:6mdra	0.145	0.651	5.571E-10	231	0.026	0.139	6mdra.pdb.gz
17	PDB:7bwnJ	0.144	0.567	7.866E-10	280	0.026	0.114	7bwnJ.pdb.gz	Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
18	PDB:2jadA	0.143	0.461	8.264E-10	346	0.026	0.092	2jadA.pdb.gz
19	PDB:4anjA	0.141	0.174	1.111E-9	995	0.026	0.032	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
20	PDB:3ai5A	0.138	0.508	1.288E-9	299	0.023	0.097	3ai5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A4X1WD80	0.0	730	1348	0.319	0.295	A0A4X1WD80_PIG Nidogen 2 OS=Sus scrofa OX=9823 GN=NID2 PE=4 SV=1
2	B5DFC9	0.0	723	1396	0.318	0.284	NID2_RAT Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1
3	F1RGY5	0.0	2081	1309	0.822	0.783	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4
4	O88322	0.0	722	1403	0.316	0.281	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
5	P10493	0.0	2166	1245	0.852	0.854	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
6	P14543	0.0	2583	1247	1.000	1.000	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
7	Q14112	0.0	759	1375	0.318	0.289	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
8	Q8IV28	0.0	687	969	0.294	0.379	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
9	P08460	4.57e-168	503	324	0.202	0.778	NID1_RAT Nidogen-1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Nid1 PE=1 SV=2
10	C7FZU4	3.92e-114	388	1248	0.283	0.283	C7FZU4_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
11	A1Z877	4.08e-66	248	1350	0.153	0.141	NDG_DROME Nidogen OS=Drosophila melanogaster OX=7227 GN=Ndg PE=1 SV=1
12	Q93791	1.56e-65	246	1584	0.164	0.129	Q93791_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=2
13	C7FZU3	2.85e-65	246	1527	0.149	0.122	C7FZU3_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
14	A0A2R8PYI8	6.04e-54	207	968	0.088	0.114	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
15	O75096	4.71e-52	204	1905	0.089	0.058	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
16	Q9QYP1	7.88e-52	203	1905	0.088	0.058	LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus OX=10116 GN=Lrp4 PE=1 SV=2
17	Q8VI56	1.62e-51	202	1905	0.090	0.059	LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus OX=10090 GN=Lrp4 PE=1 SV=3
18	D0EWS1	4.26e-51	200	1430	0.097	0.085	D0EWS1_DANRE Low density lipoprotein-related protein 6 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
19	F1QTJ4	4.34e-51	200	1615	0.097	0.075	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
20	O75197	4.41e-48	191	1615	0.083	0.064	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	9.2e-13	59.1	Complement Clr-like EGF-like
2	PF00008 EGF	2.6e-13	61.3	EGF-like domain
3	PF12947 EGF_3	3.4e-34	128.0	EGF domain
4	PF07645 EGF_CA	3.8e-12	57.5	Calcium-binding EGF domain
5	PF12946 EGF_MSP1_1	0.67	21.3	MSP1 EGF domain 1
6	PF14670 FXa_inhibition	7.9e-13	59.8	Coagulation Factor Xa inhibitory site
7	PF07474 G2F	6.7e-69	242.9	G2F domain
8	PF12661 hEGF	8.3	18.4	Human growth factor-like EGF
9	PF00058 Ldl_recept_b	3e-33	125.3	Low-density lipoprotein receptor repeat class B
10	PF06119 NIDO	6.7e-20	83.1	Nidogen-like
11	PF08450 SGL	0.44	21.7	SMP-30/Gluconolactonase/LRE-like region
12	PF00086 Thyroglobulin_1	1.8e-19	80.4	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264187

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363827	0.999	Basement membrane-specific heparan sulfate proteoglycan core protein
2	9606.ENSP00000258341	0.998	Laminin subunit gamma-1
3	9606.ENSP00000308208	0.951	Matrix metalloproteinase-14
4	9606.ENSP00000007722	0.948	Integrin alpha-3
5	9606.ENSP00000361405	0.944	Matrix metalloproteinase-9
6	9606.ENSP00000379350	0.944	Integrin beta-1
7	9606.ENSP00000354360	0.942	Laminin subunit gamma-3
8	9606.ENSP00000299855	0.940	Stromelysin-1
9	9606.ENSP00000260227	0.939	Matrilysin
10	9606.ENSP00000313437	0.934	Matrix metalloproteinase-19
11	9606.ENSP00000322788	0.934	Interstitial collagenase
12	9606.ENSP00000219271	0.930	Matrix metalloproteinase-15
13	9606.ENSP00000458585	0.929	Macrophage metalloelastase
14	9606.ENSP00000466090	0.918	Neutrophil elastase
15	9606.ENSP00000374309	0.906	Laminin subunit alpha-1
16	9606.ENSP00000398632	0.906	CD44 antigen
17	9606.ENSP00000346839	0.901	Fibronectin type III domain containing
18	9606.ENSP00000400365	0.871	Laminin subunit alpha-2
19	9606.ENSP00000222399	0.870	Laminin subunit beta-1
20	9606.ENSP00000252999	0.865	Laminin subunit alpha-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005518	1.000	collagen binding
GO:0043236	0.999	laminin binding
GO:0043394	0.850	proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0030198	0.964	extracellular matrix organization
GO:0032502	0.814	developmental process
GO:0050789	0.790	regulation of biological process
GO:0032501	0.781	multicellular organismal process
GO:0048856	0.761	anatomical structure development
GO:0050794	0.727	regulation of cellular process
GO:0007275	0.606	multicellular organism development
GO:0048518	0.457	positive regulation of biological process
GO:0007155	0.421	cell adhesion
GO:0048522	0.404	positive regulation of cellular process
GO:0048731	0.319	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0043227	0.993	membrane-bounded organelle
GO:0005604	0.954	basement membrane
GO:0031982	0.885	vesicle
GO:0005615	0.881	extracellular space
GO:0065010	0.862	extracellular membrane-bounded organelle
GO:0016020	0.851	membrane
GO:1903561	0.839	extracellular vesicle
GO:0070062	0.794	extracellular exosome
GO:0005622	0.782	intracellular anatomical structure
GO:0043229	0.592	intracellular organelle
GO:0005737	0.590	cytoplasm
GO:0043231	0.549	intracellular membrane-bounded organelle
GO:0070013	0.421	intracellular organelle lumen
GO:0012505	0.371	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]