StarFunc result for job id P14550

User Input

>input (325 residues)
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14550	1.000	1.000	1.731E-71	325	1.000	1.000	P14550.pdb.gz	AK1A1_HUMAN Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3
2	PDB:4gacA	0.977	0.980	2.352E-63	324	0.929	0.932	4gacA.pdb.gz
3	AFDB:P07943	0.926	0.952	6.930E-44	316	0.495	0.509	P07943.pdb.gz	ALDR_RAT Aldo-keto reductase family 1 member B1 OS=Rattus norvegicus OX=10116 GN=Akr1b1 PE=1 SV=3
4	AFDB:A0A0G2JT64	0.916	0.942	1.188E-43	316	0.483	0.497	A0A0G2JT64.pdb.gz	A0A0G2JT64_RAT Aldose reductase-related protein 1-like OS=Rattus norvegicus OX=10116 GN=Akr1b8 PE=1 SV=2
5	PDB:4gq0A	0.920	0.940	2.025E-43	318	0.483	0.494	4gq0A.pdb.gz	Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
6	AFDB:G5E895	0.921	0.946	3.094E-43	316	0.471	0.484	G5E895.pdb.gz	G5E895_MOUSE Aldo-keto reductase family 1, member B10 (aldose reductase) OS=Mus musculus OX=10090 GN=Akr1b10 PE=1 SV=1
7	AFDB:P21300	0.930	0.957	4.430E-43	316	0.474	0.487	P21300.pdb.gz	ALD1_MOUSE Aldo-keto reductase family 1 member B7 OS=Mus musculus OX=10090 GN=Akr1b7 PE=1 SV=4
8	AFDB:A0A024R7A8	0.927	0.953	5.629E-43	316	0.492	0.506	A0A024R7A8.pdb.gz
9	AFDB:C9JRZ8	0.925	0.951	5.976E-43	316	0.465	0.478	C9JRZ8.pdb.gz	AK1BF_HUMAN Aldo-keto reductase family 1 member B15 OS=Homo sapiens OX=9606 GN=AKR1B15 PE=1 SV=2
10	AFDB:Q5RJP0	0.940	0.967	8.557E-43	316	0.465	0.478	Q5RJP0.pdb.gz	ALD1_RAT Aldo-keto reductase family 1 member B7 OS=Rattus norvegicus OX=10116 GN=Akr1b7 PE=1 SV=1
11	AFDB:M9PF61	0.931	0.865	9.085E-43	350	0.468	0.434	M9PF61.pdb.gz	M9PF61_DROME Aldo-keto reductase 1B, isoform C OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=1
12	AFDB:Q90W83	0.937	0.961	1.653E-42	317	0.471	0.483	Q90W83.pdb.gz	Q90W83_CHICK Aldo-keto reductase OS=Gallus gallus OX=9031 GN=akr PE=2 SV=1
13	PDB:3o3rA	0.941	0.971	3.802E-42	315	0.465	0.479	3o3rA.pdb.gz	Structure of rat aldose reductase-like protein AKR1B14 holoenzyme: Probing the role of His269 in coenzyme binding by site-directed mutagenesis
14	PDB:3rx2A	0.928	0.948	3.802E-42	318	0.492	0.503	3rx2A.pdb.gz	The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
15	PDB:2fvlA	0.911	0.916	1.919E-39	323	0.418	0.421	2fvlA.pdb.gz	Crystal structure of human 3-alpha hydroxysteroid/dihydrodiol dehydrogenase (AKR1C4) complexed with NADP+
16	PDB:4l1wA	0.921	0.921	9.658E-39	325	0.437	0.437	4l1wA.pdb.gz	Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
17	PDB:3burA	0.936	0.936	3.011E-38	325	0.446	0.446	3burA.pdb.gz	Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
18	PDB:4zfcB	0.894	0.908	5.816E-38	320	0.406	0.412	4zfcB.pdb.gz	In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
19	PDB:3cv6A	0.913	0.919	1.193E-37	323	0.397	0.399	3cv6A.pdb.gz	Structure of the G225P/G226P mutant of mouse 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) ternary complex: implications for the binding of inhibitor and substrate.
20	PDB:3ln3A	0.914	0.931	2.170E-37	319	0.425	0.433	3ln3A.pdb.gz	Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14550	0.0	674	325	1.000	1.000	AK1A1_HUMAN Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3
2	P51635	0.0	643	325	0.942	0.942	AK1A1_RAT Aldo-keto reductase family 1 member A1 OS=Rattus norvegicus OX=10116 GN=Akr1a1 PE=1 SV=2
3	Q9JII6	0.0	637	325	0.932	0.932	AK1A1_MOUSE Aldo-keto reductase family 1 member A1 OS=Mus musculus OX=10090 GN=Akr1a1 PE=1 SV=3
4	O60218	4.21e-108	319	316	0.489	0.503	AK1BA_HUMAN Aldo-keto reductase family 1 member B10 OS=Homo sapiens OX=9606 GN=AKR1B10 PE=1 SV=2
5	Q90W83	1.02e-106	316	317	0.471	0.483	Q90W83_CHICK Aldo-keto reductase OS=Gallus gallus OX=9031 GN=akr PE=2 SV=1
6	C9JRZ8	5.41e-104	309	316	0.455	0.468	AK1BF_HUMAN Aldo-keto reductase family 1 member B15 OS=Homo sapiens OX=9606 GN=AKR1B15 PE=1 SV=2
7	P15121	1.62e-100	300	316	0.495	0.509	ALDR_HUMAN Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3
8	P45376	4.05e-100	299	316	0.498	0.513	ALDR_MOUSE Aldo-keto reductase family 1 member B1 OS=Mus musculus OX=10090 GN=Akr1b1 PE=1 SV=3
9	P07943	1.53e-99	297	316	0.498	0.513	ALDR_RAT Aldo-keto reductase family 1 member B1 OS=Rattus norvegicus OX=10116 GN=Akr1b1 PE=1 SV=3
10	Q8T492	6.50e-99	296	322	0.452	0.457	Q8T492_DROME AT08919p OS=Drosophila melanogaster OX=7227 GN=CG6083 PE=2 SV=1
11	Q9VTL0	7.57e-99	296	322	0.452	0.457	Q9VTL0_DROME FI19917p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6083 PE=2 SV=2
12	G3V786	1.76e-97	292	310	0.468	0.490	G3V786_RAT Aldose reductase-related protein 1-like OS=Rattus norvegicus OX=10116 GN=Akr1b8 PE=3 SV=2
13	P21300	2.12e-97	292	316	0.480	0.494	ALD1_MOUSE Aldo-keto reductase family 1 member B7 OS=Mus musculus OX=10090 GN=Akr1b7 PE=1 SV=4
14	A0A8I5ZY17	2.78e-97	291	303	0.468	0.502	A0A8I5ZY17_RAT Aldose reductase-related protein 1-like OS=Rattus norvegicus OX=10116 GN=Akr1b8 PE=1 SV=1
15	G5E895	1.06e-96	290	316	0.465	0.478	G5E895_MOUSE Aldo-keto reductase family 1, member B10 (aldose reductase) OS=Mus musculus OX=10090 GN=Akr1b10 PE=1 SV=1
16	Q8BIV6	1.25e-96	290	316	0.465	0.478	Q8BIV6_MOUSE NADP-dependent oxidoreductase domain-containing protein OS=Mus musculus OX=10090 GN=Akr1b10 PE=2 SV=1
17	M9PI17	3.04e-96	289	316	0.489	0.503	M9PI17_DROME Aldo-keto reductase 1B, isoform D OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=1
18	Q5RJP0	7.30e-95	285	316	0.465	0.478	ALD1_RAT Aldo-keto reductase family 1 member B7 OS=Rattus norvegicus OX=10116 GN=Akr1b7 PE=1 SV=1
19	Q9VTK9	2.78e-94	284	316	0.477	0.491	Q9VTK9_DROME Aldo-keto reductase 1B, isoform A OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=2
20	Q2TJA5	1.48e-93	282	322	0.443	0.447	Q2TJA5_PIG Aldo-keto reductase OS=Sus scrofa OX=9823 GN=AKR1C8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	1.2e-50	183.8	Aldo/keto reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346827	0.954	4-trimethylaminobutyraldehyde dehydrogenase
2	9606.ENSP00000345774	0.952	Fatty aldehyde dehydrogenase
3	9606.ENSP00000216075	0.951	Belongs to the myo-inositol oxygenase family.
4	9606.ENSP00000261733	0.944	Aldehyde dehydrogenase, mitochondrial
5	9606.ENSP00000366927	0.944	Aldehyde dehydrogenase X, mitochondrial
6	9606.ENSP00000255084	0.943	Aldehyde dehydrogenase family 3 member B2
7	9606.ENSP00000387123	0.938	Alpha-aminoadipic semialdehyde dehydrogenase
8	9606.ENSP00000411821	0.934	Aldehyde dehydrogenase, dimeric NADP-preferring
9	9606.ENSP00000473990	0.930	Aldehyde dehydrogenase family 3 member B1
10	9606.ENSP00000401720	0.928	Glycerol kinase
11	9606.ENSP00000367309	0.926	Amine oxidase [flavin-containing] B
12	9606.ENSP00000351706	0.919	Glycerol kinase 2
13	9606.ENSP00000298248	0.916	Lambda-crystallin homolog
14	9606.ENSP00000302728	0.911	Beta-glucuronidase
15	9606.ENSP00000369442	0.904	Klotho
16	9606.ENSP00000265052	0.902	Monoglyceride lipase
17	9606.ENSP00000235835	0.836	Aflatoxin B1 aldehyde reductase member 2
18	9606.ENSP00000290354	0.794	Carbonyl reductase [NADPH] 3
19	9606.ENSP00000290349	0.755	Carbonyl reductase [NADPH] 1
20	9606.ENSP00000379087	0.732	ADM2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008106	0.997	alcohol dehydrogenase (NADP+) activity
GO:0005488	0.996	binding
GO:0004032	0.992	alditol:NADP+ 1-oxidoreductase activity
GO:0005515	0.961	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0071704	0.998	organic substance metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0009056	0.992	catabolic process
GO:0009058	0.931	biosynthetic process
GO:0044282	0.911	small molecule catabolic process
GO:1901576	0.887	organic substance biosynthetic process
GO:0006082	0.867	organic acid metabolic process
GO:0044238	0.846	primary metabolic process
GO:1901360	0.805	organic cyclic compound metabolic process
GO:0032787	0.778	monocarboxylic acid metabolic process
GO:1901575	0.740	organic substance catabolic process
GO:0046395	0.635	carboxylic acid catabolic process
GO:0044249	0.602	cellular biosynthetic process
GO:0050896	0.588	response to stimulus
GO:0006807	0.492	nitrogen compound metabolic process
GO:0042221	0.359	response to chemical
GO:1901615	0.357	organic hydroxy compound metabolic process
GO:1901564	0.318	organonitrogen compound metabolic process
GO:0072329	0.300	monocarboxylic acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.999	membrane-bounded organelle
GO:0005615	0.995	extracellular space
GO:0070062	0.958	extracellular exosome
GO:0043231	0.767	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15937	0.997	a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH
EC:1.1.1.2	0.997	alcohol dehydrogenase (NADP(+)).
RHEA:12789	0.992	an alditol + NADP(+) = an aldose + H(+) + NADPH
EC:1.1.1.21	0.992	aldose reductase.

[back to server]