StarFunc result for job id P14598

User Input

>input (390 residues)
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPI
EAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKV
RPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTG
DVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAV
EGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP
RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSK
PQPAVPPRPSADLILNRCSESTKRKLASAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14598	1.000	1.000	2.568E-74	390	1.000	1.000	P14598.pdb.gz	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
2	AFDB:Q09014	0.941	0.941	5.562E-65	390	0.821	0.821	Q09014.pdb.gz	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
3	AFDB:B5X4S7	0.609	0.581	8.408E-50	413	0.544	0.513	B5X4S7.pdb.gz	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
4	AFDB:A2BFP2	0.497	0.474	3.590E-49	410	0.551	0.524	A2BFP2.pdb.gz
5	AFDB:A1X283	0.322	0.141	1.965E-29	911	0.310	0.133	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
6	AFDB:Q5TCZ1	0.325	0.115	2.990E-27	1133	0.297	0.102	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
7	AFDB:A2AAY5	0.318	0.140	3.535E-27	908	0.290	0.124	A2AAY5.pdb.gz	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
8	AFDB:Q1LYG0	0.327	0.117	7.725E-27	1119	0.292	0.102	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
9	AFDB:Q8NFA2	0.332	0.343	4.561E-21	376	0.226	0.234	Q8NFA2.pdb.gz	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
10	AFDB:Q8VCM2	0.351	0.390	4.823E-21	349	0.226	0.252	Q8VCM2.pdb.gz	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
11	PDB:2dybA	0.231	0.296	5.002E-11	298	0.136	0.178	2dybA.pdb.gz
12	PDB:1griA	0.136	0.245	5.457E-5	211	0.077	0.142	1griA.pdb.gz
13	PDB:2lqnA	0.137	0.173	1.066E-4	303	0.074	0.096	2lqnA.pdb.gz
14	PDB:2eyzA	0.159	0.196	3.258E-4	304	0.087	0.112	2eyzA.pdb.gz
15	PDB:3ehqA	0.141	0.293	9.952E-4	182	0.044	0.093	3ehqA.pdb.gz
16	PDB:1ocuA	0.246	0.643	1.177E-3	134	0.059	0.172	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
17	PDB:2h8hA	0.141	0.124	1.556E-3	445	0.064	0.056	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:4mt6A	0.127	0.127	1.739E-3	389	0.044	0.044	4mt6A.pdb.gz
19	PDB:1k9aB	0.136	0.120	2.571E-3	441	0.044	0.039	1k9aB.pdb.gz
20	PDB:3qwyA	0.139	0.310	4.494E-3	170	0.056	0.129	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M707	0.0	680	389	0.823	0.825	NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus OX=10116 GN=Ncf1 PE=1 SV=2
2	P14598	0.0	811	390	1.000	1.000	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
3	Q09014	0.0	679	390	0.821	0.821	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
4	Q4Z8P3	2.42e-155	446	410	0.546	0.520	Q4Z8P3_DANRE Neutrophil cytosol factor 1 OS=Danio rerio OX=7955 GN=cb893 PE=2 SV=1
5	B8YQ98	1.98e-154	443	413	0.546	0.516	B8YQ98_SALSA NADPH oxidase cytosolic protein OS=Salmo salar OX=8030 GN=p47phox PE=2 SV=1
6	B5X4S7	6.09e-154	442	413	0.549	0.518	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
7	A1X283	2.94e-58	206	911	0.274	0.117	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
8	A2AAY5	2.24e-56	200	908	0.267	0.115	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
9	O89032	7.43e-56	200	1124	0.274	0.095	SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus OX=10090 GN=Sh3pxd2a PE=1 SV=2
10	Q5TCZ1	9.02e-56	199	1133	0.274	0.094	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
11	Q1LYG0	6.83e-53	191	1119	0.256	0.089	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
12	Q8NFA2	5.91e-24	103	376	0.187	0.194	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
13	Q8VCM2	2.13e-20	93.6	349	0.190	0.212	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
14	Q9NZM3	4.66e-13	73.6	1697	0.110	0.025	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
15	Q9Z0R6	9.22e-12	69.3	1659	0.126	0.030	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
16	P97369	1.69e-11	67.0	339	0.159	0.183	NCF4_MOUSE Neutrophil cytosol factor 4 OS=Mus musculus OX=10090 GN=Ncf4 PE=1 SV=2
17	A0A1D8PLB6	1.37e-09	62.0	632	0.090	0.055	A0A1D8PLB6_CANAL Phosphatidylinositol-3-phosphate-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM1 PE=4 SV=1
18	H0YKF1	1.57e-09	57.8	133	0.059	0.173	H0YKF1_HUMAN Proline-serine-threonine phosphatase interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1
19	Q9Z0R4	1.74e-09	62.4	1714	0.110	0.025	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
20	O61639	2.39e-09	61.6	1011	0.110	0.043	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	39	16.2	Helically-extended SH3 domain
2	PF16621 NECFESHC	5.6e-18	75.9	SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
3	PF08944 p47_phox_C	1.5e-16	70.8	NADPH oxidase subunit p47Phox, C terminal domain
4	PF00787 PX	3.8e-15	67.7	PX domain
5	PF00018 SH3_1	1.1e-24	97.1	SH3 domain
6	PF07653 SH3_2	8.1e-14	62.5	Variant SH3 domain
7	PF08239 SH3_3	14	17.5	Bacterial SH3 domain
8	PF12913 SH3_6	1.7e+02	13.2	SH3 domain (SH3b1 type)
9	PF14604 SH3_9	3.1e-18	76.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261623	0.999	Cytochrome b-245 light chain
2	9606.ENSP00000356505	0.999	Neutrophil cytosol factor 2
3	9606.ENSP00000367851	0.999	Cytochrome b-245 heavy chain
4	9606.ENSP00000380334	0.998	Neutrophil cytosol factor 4
5	9606.ENSP00000362057	0.997	NADPH oxidase 1
6	9606.ENSP00000249071	0.995	Ras-related C3 botulinum toxin substrate 2
7	9606.ENSP00000305355	0.992	Protein kinase C beta type
8	9606.ENSP00000367830	0.991	Protein kinase C zeta type
9	9606.ENSP00000342848	0.990	NADPH oxidase activator 1
10	9606.ENSP00000378217	0.988	Protein kinase C delta type
11	9606.ENSP00000451828	0.987	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000262395	0.982	TNF receptor-associated factor 4
13	9606.ENSP00000408695	0.981	Protein kinase C alpha type
14	9606.ENSP00000348461	0.969	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000263317	0.966	NADPH oxidase 4
16	9606.ENSP00000159060	0.964	NADPH oxidase 3
17	9606.ENSP00000278568	0.963	Serine/threonine-protein kinase PAK 1
18	9606.ENSP00000229795	0.956	Mitogen-activated protein kinase 14
19	9606.ENSP00000263025	0.954	Mitogen-activated protein kinase 3
20	9606.ENSP00000353408	0.954	Moesin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.981	lipid binding
GO:0005543	0.953	phospholipid binding
GO:0043167	0.936	ion binding
GO:0035091	0.935	phosphatidylinositol binding
GO:0003824	0.922	catalytic activity
GO:0043168	0.915	anion binding
GO:0043325	0.851	phosphatidylinositol-3,4-bisphosphate binding
GO:0098772	0.660	molecular function regulator activity
GO:0030234	0.558	enzyme regulator activity
GO:0140677	0.553	molecular function activator activity
GO:0008047	0.507	enzyme activator activity
GO:0016176	0.426	superoxide-generating NADPH oxidase activator activity
GO:0016491	0.348	oxidoreductase activity
GO:0016651	0.318	oxidoreductase activity, acting on NAD(P)H

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.997	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0008152	0.993	metabolic process
GO:0048583	0.989	regulation of response to stimulus
GO:0044419	0.970	biological process involved in interspecies interaction between organisms
GO:0070887	0.960	cellular response to chemical stimulus
GO:0050794	0.956	regulation of cellular process
GO:0048522	0.948	positive regulation of cellular process
GO:0006950	0.896	response to stress
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0006952	0.873	defense response
GO:0009893	0.870	positive regulation of metabolic process
GO:0044237	0.863	cellular metabolic process
GO:0010646	0.846	regulation of cell communication
GO:0023051	0.845	regulation of signaling
GO:0080090	0.837	regulation of primary metabolic process
GO:0009607	0.832	response to biotic stimulus
GO:0009966	0.823	regulation of signal transduction
GO:1901700	0.818	response to oxygen-containing compound
GO:0009605	0.817	response to external stimulus
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0080134	0.799	regulation of response to stress
GO:0031323	0.781	regulation of cellular metabolic process
GO:0072593	0.757	reactive oxygen species metabolic process
GO:0031325	0.734	positive regulation of cellular metabolic process
GO:0006801	0.714	superoxide metabolic process
GO:0048584	0.713	positive regulation of response to stimulus
GO:0065009	0.642	regulation of molecular function
GO:0051179	0.619	localization
GO:1901701	0.613	cellular response to oxygen-containing compound
GO:1902531	0.600	regulation of intracellular signal transduction
GO:0051707	0.580	response to other organism
GO:0051174	0.569	regulation of phosphorus metabolic process
GO:0071704	0.556	organic substance metabolic process
GO:0044093	0.546	positive regulation of molecular function
GO:0002376	0.536	immune system process
GO:0010604	0.533	positive regulation of macromolecule metabolic process
GO:0051246	0.525	regulation of protein metabolic process
GO:0019220	0.517	regulation of phosphate metabolic process
GO:0050790	0.515	regulation of catalytic activity
GO:0042325	0.504	regulation of phosphorylation
GO:0009967	0.498	positive regulation of signal transduction
GO:0007154	0.489	cell communication
GO:0051173	0.485	positive regulation of nitrogen compound metabolic process
GO:0023052	0.478	signaling
GO:0031399	0.475	regulation of protein modification process
GO:0007165	0.465	signal transduction
GO:0001932	0.456	regulation of protein phosphorylation
GO:0010468	0.448	regulation of gene expression
GO:0010033	0.436	response to organic substance
GO:0044238	0.406	primary metabolic process
GO:0042327	0.400	positive regulation of phosphorylation
GO:0051239	0.386	regulation of multicellular organismal process
GO:0032501	0.365	multicellular organismal process
GO:0043085	0.358	positive regulation of catalytic activity
GO:0051247	0.357	positive regulation of protein metabolic process
GO:0048519	0.333	negative regulation of biological process
GO:0051338	0.333	regulation of transferase activity
GO:0002682	0.321	regulation of immune system process
GO:0048523	0.310	negative regulation of cellular process
GO:0006968	0.308	cellular defense response
GO:0009889	0.301	regulation of biosynthetic process
GO:0098542	0.301	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0071944	0.989	cell periphery
GO:0043226	0.986	organelle
GO:0043229	0.967	intracellular organelle
GO:0005886	0.965	plasma membrane
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0032991	0.922	protein-containing complex
GO:0031982	0.866	vesicle
GO:0031410	0.763	cytoplasmic vesicle
GO:0098797	0.679	plasma membrane protein complex
GO:1902494	0.665	catalytic complex
GO:0012505	0.634	endomembrane system
GO:1990204	0.397	oxidoreductase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.348	Oxidoreductases.
EC:1.6.-.-	0.318	Acting on NADH or NADPH.

[back to server]