StarFunc result for job id P14616

User Input

>input (1297 residues)
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRG
LRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEY
FSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
PRECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY
YSPECRGARGSLPTTDAEPDSSPTPRDCSPQNGGPGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IGP2	0.718	0.657	0.000	1433	0.530	0.479	A0A0R4IGP2.pdb.gz
2	AFDB:B0R0Q2	0.822	0.776	0.000	1380	0.527	0.496	B0R0Q2.pdb.gz
3	AFDB:F1QNX5	0.847	0.813	0.000	1353	0.518	0.497	F1QNX5.pdb.gz
4	AFDB:O73798	0.820	0.786	0.000	1358	0.537	0.513	O73798.pdb.gz	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
5	AFDB:P09208	0.541	0.350	0.000	2144	0.377	0.228	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
6	AFDB:P14616	1.000	1.000	0.000	1297	1.000	1.000	P14616.pdb.gz	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
7	AFDB:P15127	0.683	0.648	0.000	1383	0.535	0.502	P15127.pdb.gz	INSR_RAT Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1
8	AFDB:Q1LVG4	0.622	0.600	0.000	1348	0.508	0.489	Q1LVG4.pdb.gz	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
9	AFDB:Q60751	0.683	0.649	0.000	1373	0.562	0.531	Q60751.pdb.gz	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
10	AFDB:Q64716	0.924	0.922	0.000	1300	0.888	0.886	Q64716.pdb.gz	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
11	PDB:6pxvA	0.269	0.411	2.135E-103	823	0.329	0.519	6pxvA.pdb.gz
12	PDB:8dtlA	0.349	0.574	2.010E-92	741	0.305	0.534	8dtlA.pdb.gz
13	PDB:8eyyA	0.351	0.560	1.860E-90	775	0.309	0.517	8eyyA.pdb.gz
14	PDB:6pyhD	0.270	0.424	5.089E-90	798	0.339	0.551	6pyhD.pdb.gz
15	PDB:7bwaA	0.261	0.423	4.769E-68	674	0.278	0.536	7bwaA.pdb.gz
16	PDB:2h8hA	0.186	0.515	4.233E-25	445	0.094	0.274	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:4fl2A	0.187	0.418	1.134E-22	555	0.086	0.202	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
18	PDB:1k9aB	0.189	0.531	3.837E-21	441	0.086	0.252	1k9aB.pdb.gz
19	PDB:4k2rA	0.184	0.420	9.385E-21	551	0.078	0.183	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
20	PDB:7mn8B	0.188	0.378	3.359E-19	579	0.089	0.199	7mn8B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4UQS4	946	1454	0.433	0.387	A0A0C4UQS4_NILLU Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1
2	A0A0C4UR07	776	1427	0.370	0.336	A0A0C4UR07_NILLU Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1
3	B7SNG4	1313	1353	0.516	0.494	B7SNG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRa PE=1 SV=1
4	G1K218	1433	1367	0.556	0.527	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3
5	I3PGL2	641	477	0.247	0.671	I3PGL2_BOVIN Tyrosine-protein kinase receptor (Fragment) OS=Bos taurus OX=9913 GN=IGFR1 PE=2 SV=1
6	O73798	1387	1358	0.546	0.521	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
7	P06213	1365	1382	0.534	0.501	INSR_HUMAN Insulin receptor OS=Homo sapiens OX=9606 GN=INSR PE=1 SV=4
8	P08069	1447	1367	0.558	0.530	IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1
9	P09208	742	2144	0.389	0.235	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
10	P14616	2682	1297	1.000	1.000	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
11	P15127	1358	1383	0.536	0.503	INSR_RAT Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1
12	P15208	1362	1372	0.531	0.502	INSR_MOUSE Insulin receptor OS=Mus musculus OX=10090 GN=Insr PE=1 SV=2
13	P24062	1445	1370	0.560	0.530	IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Igf1r PE=2 SV=2
14	Q05688	693	640	0.264	0.534	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
15	Q1LVG4	1293	1348	0.507	0.487	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
16	Q60751	1439	1373	0.560	0.529	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
17	Q64716	2383	1300	0.892	0.890	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
18	Q9PVZ4	1350	1362	0.526	0.501	INSR_XENLA Insulin receptor OS=Xenopus laevis OX=8355 GN=insr PE=1 SV=1
19	Q9PWN6	996	989	0.393	0.516	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
20	Q9WTL4	2381	1300	0.891	0.889	INSRR_MOUSE Insulin receptor-related protein OS=Mus musculus OX=10090 GN=Insrr PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	5.2e-17	73.3	Fibronectin type III domain
2	PF00757 Furin-like	3.3e-31	119.6	Furin-like cysteine rich region
3	PF14531 Kinase-like	73	14.1	Kinase-like
4	PF00069 Pkinase	1.8e-35	134.2	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	7.6e-86	299.2	Protein tyrosine and serine/threonine kinase
6	PF01030 Recep_L_domain	5.5e-46	166.6	Receptor L domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303830	0.930	Insulin receptor
2	9606.ENSP00000268035	0.906	Insulin-like growth factor 1 receptor
3	9606.ENSP00000380432	0.889	Insulin
4	9606.ENSP00000302665	0.873	Insulin-like growth factor I
5	9606.ENSP00000376345	0.872	Growth factor receptor-bound protein 2
6	9606.ENSP00000360683	0.857	Tyrosine-protein phosphatase non-receptor type 1
7	9606.ENSP00000304895	0.835	Insulin receptor substrate 1
8	9606.ENSP00000263967	0.775	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
9	9606.ENSP00000222254	0.752	Phosphatidylinositol 3-kinase regulatory subunit beta
10	9606.ENSP00000289153	0.752	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
11	9606.ENSP00000428056	0.752	Phosphatidylinositol 3-kinase regulatory subunit alpha
12	9606.ENSP00000366563	0.746	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
13	9606.ENSP00000262741	0.733	Phosphatidylinositol 3-kinase regulatory subunit gamma
14	9606.ENSP00000371790	0.687	Fibroblast growth factor 9
15	9606.ENSP00000216373	0.683	Son of sevenless homolog 2
16	9606.ENSP00000361021	0.673	Phosphatase and tensin homolog
17	9606.ENSP00000387784	0.662	Son of sevenless homolog 1
18	9606.ENSP00000228837	0.655	Fibroblast growth factor 6
19	9606.ENSP00000399585	0.649	Magnesium transporter MRS2 homolog, mitochondrial
20	9606.ENSP00000352414	0.641	Fibroblast growth factor 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004714	0.997	transmembrane receptor protein tyrosine kinase activity
GO:0019838	0.916	growth factor binding
GO:0098772	0.859	molecular function regulator activity
GO:0005520	0.807	insulin-like growth factor binding
GO:0019899	0.564	enzyme binding
GO:0030234	0.507	enzyme regulator activity
GO:0140678	0.348	molecular function inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0050896	0.991	response to stimulus
GO:0044237	0.989	cellular metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006796	0.979	phosphate-containing compound metabolic process
GO:0051716	0.977	cellular response to stimulus
GO:1901564	0.977	organonitrogen compound metabolic process
GO:0019538	0.965	protein metabolic process
GO:0036211	0.960	protein modification process
GO:0016310	0.950	phosphorylation
GO:0006468	0.938	protein phosphorylation
GO:0046777	0.924	protein autophosphorylation
GO:0050794	0.886	regulation of cellular process
GO:0007165	0.772	signal transduction
GO:0032502	0.641	developmental process
GO:0032501	0.635	multicellular organismal process
GO:0048856	0.567	anatomical structure development
GO:0010446	0.531	response to alkaline pH
GO:0048522	0.480	positive regulation of cellular process
GO:0007166	0.448	cell surface receptor signaling pathway
GO:0007169	0.421	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275	0.419	multicellular organism development
GO:0019222	0.417	regulation of metabolic process
GO:0031323	0.382	regulation of cellular metabolic process
GO:0048519	0.378	negative regulation of biological process
GO:0060255	0.372	regulation of macromolecule metabolic process
GO:0048583	0.364	regulation of response to stimulus
GO:0048523	0.354	negative regulation of cellular process
GO:0009893	0.354	positive regulation of metabolic process
GO:0071214	0.349	cellular response to abiotic stimulus
GO:0071840	0.317	cellular component organization or biogenesis
GO:0080090	0.316	regulation of primary metabolic process
GO:0042221	0.308	response to chemical
GO:0051171	0.303	regulation of nitrogen compound metabolic process
GO:0009966	0.302	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0110165	0.988	cellular anatomical entity
GO:0016020	0.980	membrane
GO:0032991	0.972	protein-containing complex
GO:0005886	0.965	plasma membrane
GO:0005622	0.881	intracellular anatomical structure
GO:0005737	0.820	cytoplasm
GO:0043235	0.667	receptor complex
GO:0043226	0.641	organelle
GO:0043227	0.583	membrane-bounded organelle
GO:0043229	0.311	intracellular organelle
GO:0043231	0.304	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.997	receptor protein-tyrosine kinase.

[back to server]