StarFunc result for job id P14635

User Input

>input (433 residues)
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24860	0.773	0.779	7.792E-47	430	0.859	0.865	P24860.pdb.gz	CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus OX=10090 GN=Ccnb1 PE=1 SV=3
2	AFDB:Q9IB44	0.701	0.762	1.025E-36	398	0.596	0.648	Q9IB44.pdb.gz	Q9IB44_DANRE G2/mitotic-specific cyclin-B1 OS=Danio rerio OX=7955 GN=wu:fb16d01 PE=1 SV=1
3	AFDB:P13351	0.685	0.755	1.023E-32	392	0.480	0.531	P13351.pdb.gz	CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis OX=8355 GN=ccnb2 PE=1 SV=1
4	AFDB:O95067	0.689	0.748	3.395E-32	398	0.483	0.525	O95067.pdb.gz	CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1
5	AFDB:P30276	0.696	0.754	6.454E-32	398	0.494	0.538	P30276.pdb.gz	CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus OX=10090 GN=Ccnb2 PE=1 SV=2
6	PDB:7nj0C	0.618	0.988	2.345E-31	270	0.621	0.996	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
7	AFDB:P42524	0.613	0.609	8.861E-22	436	0.279	0.278	P42524.pdb.gz	CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum OX=44689 GN=cycB PE=1 SV=1
8	AFDB:O48790	0.625	0.696	1.685E-21	387	0.291	0.326	O48790.pdb.gz	CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-4 PE=2 SV=1
9	AFDB:Q39070	0.605	0.611	4.141E-21	429	0.273	0.275	Q39070.pdb.gz	CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-2 PE=1 SV=2
10	AFDB:Q39068	0.588	0.594	6.089E-21	429	0.263	0.266	Q39068.pdb.gz	CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-1 PE=1 SV=2
11	AFDB:Q6NV43	0.581	0.588	6.924E-21	428	0.284	0.287	Q6NV43.pdb.gz	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
12	PDB:7b5lY	0.543	0.919	1.407E-14	253	0.212	0.364	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
13	PDB:2w96A	0.478	0.810	1.759E-9	249	0.127	0.221	2w96A.pdb.gz
14	PDB:3g33B	0.476	0.877	6.634E-9	229	0.127	0.240	3g33B.pdb.gz
15	PDB:1g3nC	0.443	0.798	3.270E-7	233	0.083	0.155	1g3nC.pdb.gz
16	PDB:6gzhB	0.426	0.703	6.913E-5	252	0.083	0.143	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
17	PDB:5hbhB	0.388	0.600	1.628E-4	270	0.092	0.148	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
18	PDB:7kpvB	0.373	0.534	2.394E-4	290	0.079	0.117	7kpvB.pdb.gz
19	PDB:7jv7B	0.392	0.532	3.231E-4	310	0.072	0.100	7jv7B.pdb.gz
20	PDB:1zp2A	0.339	0.608	4.958E-4	227	0.081	0.154	1zp2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D2IE28	0.0	778	435	0.917	0.913	D2IE28_PIG G2/mitotic-specific cyclin-B1 OS=Sus scrofa OX=9823 GN=CCNB1 PE=2 SV=1
2	E9PC90	0.0	825	401	0.919	0.993	E9PC90_HUMAN G2/mitotic-specific cyclin-B1 (Fragment) OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1
3	P13350	0.0	550	397	0.644	0.703	CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis OX=8355 GN=ccnb1 PE=1 SV=1
4	P14635	0.0	893	433	1.000	1.000	CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1
5	P24860	0.0	751	430	0.841	0.847	CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus OX=10090 GN=Ccnb1 PE=1 SV=3
6	P30277	0.0	745	423	0.848	0.868	CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus OX=10116 GN=Ccnb1 PE=2 SV=1
7	Q9IB44	0.0	527	398	0.610	0.663	Q9IB44_DANRE G2/mitotic-specific cyclin-B1 OS=Danio rerio OX=7955 GN=wu:fb16d01 PE=1 SV=1
8	D6RHI0	1.29e-168	474	244	0.564	1.000	D6RHI0_HUMAN Cyclin B1 (Fragment) OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1
9	P30276	6.32e-142	412	398	0.494	0.538	CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus OX=10090 GN=Ccnb2 PE=1 SV=2
10	O95067	3.28e-141	411	398	0.485	0.528	CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1
11	P29332	9.55e-141	410	399	0.492	0.534	CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus OX=9031 GN=CCNB2 PE=2 SV=1
12	P13351	5.23e-140	407	392	0.492	0.543	CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis OX=8355 GN=ccnb2 PE=1 SV=1
13	A9ZPH4	3.56e-138	403	396	0.476	0.520	A9ZPH4_PIG Cyclin B2 OS=Sus scrofa OX=9823 GN=CCNB2 PE=2 SV=1
14	H1UBN3	3.14e-127	374	374	0.441	0.511	H1UBN3_HUMAN Cyclin B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1
15	P20439	2.09e-77	251	530	0.298	0.243	CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster OX=7227 GN=CycB PE=1 SV=2
16	P10815	1.37e-63	214	482	0.261	0.234	CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc13 PE=1 SV=1
17	Q9FMH5	7.34e-59	198	355	0.254	0.310	CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-1 PE=3 SV=1
18	P42524	1.11e-57	197	436	0.231	0.229	CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum OX=44689 GN=cycB PE=1 SV=1
19	Q9C6A9	2.08e-57	195	372	0.259	0.301	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
20	A0MEB5	4.39e-57	192	327	0.263	0.349	CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02703 Adeno_E1A	5.3	18.2	Early E1A protein
2	PF02984 Cyclin_C	6.8e-33	124.7	Cyclin, C-terminal domain
3	PF00134 Cyclin_N	2e-40	148.9	Cyclin, N-terminal domain
4	PF16031 TonB_N	36	16.3	TonB polyproline region
5	PF05887 Trypan_PARP	2.1e+02	13.3	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000303706	0.999	M-phase inducer phosphatase 1
4	9606.ENSP00000332353	0.999	Protein patched homolog 1
5	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
6	9606.ENSP00000364976	0.999	Cyclin-dependent kinases regulatory subunit 2
7	9606.ENSP00000378529	0.999	Fizzy-related protein homolog
8	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
9	9606.ENSP00000287598	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
10	9606.ENSP00000288207	0.998	G2/mitotic-specific cyclin-B2
11	9606.ENSP00000302530	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1
12	9606.ENSP00000321656	0.998	M-phase inducer phosphatase 3
13	9606.ENSP00000384849	0.998	Cyclin-dependent kinase inhibitor 1
14	9606.ENSP00000262300	0.997	Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
15	9606.ENSP00000342307	0.997	Forkhead box protein M1
16	9606.ENSP00000257934	0.996	Separin
17	9606.ENSP00000274026	0.996	Cyclin-A2
18	9606.ENSP00000311083	0.996	Cyclin-dependent kinases regulatory subunit 1
19	9606.ENSP00000251496	0.994	Condensin complex subunit 3
20	9606.ENSP00000348838	0.993	Ubiquitin-conjugating enzyme E2 C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019899	0.849	enzyme binding
GO:0019900	0.757	kinase binding
GO:0019901	0.669	protein kinase binding
GO:0016538	0.483	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0030234	0.422	enzyme regulator activity
GO:0061575	0.375	cyclin-dependent protein serine/threonine kinase activator activity
GO:0003824	0.350	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048522	0.965	positive regulation of cellular process
GO:0051726	0.961	regulation of cell cycle
GO:0010948	0.901	negative regulation of cell cycle process
GO:0045787	0.771	positive regulation of cell cycle
GO:0019222	0.738	regulation of metabolic process
GO:0008152	0.725	metabolic process
GO:0071704	0.716	organic substance metabolic process
GO:2000242	0.706	negative regulation of reproductive process
GO:0071840	0.673	cellular component organization or biogenesis
GO:0016043	0.625	cellular component organization
GO:0007049	0.610	cell cycle
GO:0045595	0.609	regulation of cell differentiation
GO:0044237	0.607	cellular metabolic process
GO:0044238	0.605	primary metabolic process
GO:0060255	0.603	regulation of macromolecule metabolic process
GO:0022402	0.572	cell cycle process
GO:0080090	0.572	regulation of primary metabolic process
GO:0006807	0.561	nitrogen compound metabolic process
GO:0051171	0.560	regulation of nitrogen compound metabolic process
GO:0006996	0.543	organelle organization
GO:0043170	0.530	macromolecule metabolic process
GO:0000278	0.525	mitotic cell cycle
GO:0031323	0.525	regulation of cellular metabolic process
GO:0032501	0.469	multicellular organismal process
GO:0050896	0.435	response to stimulus
GO:0033044	0.431	regulation of chromosome organization
GO:0009893	0.415	positive regulation of metabolic process
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0032502	0.399	developmental process
GO:0048856	0.358	anatomical structure development
GO:1903047	0.351	mitotic cell cycle process
GO:0010604	0.346	positive regulation of macromolecule metabolic process
GO:0007346	0.318	regulation of mitotic cell cycle
GO:0051716	0.313	cellular response to stimulus
GO:1901564	0.313	organonitrogen compound metabolic process
GO:0051173	0.307	positive regulation of nitrogen compound metabolic process
GO:0031325	0.301	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.978	intracellular organelle lumen
GO:0005829	0.977	cytosol
GO:0032991	0.941	protein-containing complex
GO:0005654	0.939	nucleoplasm
GO:0043232	0.869	intracellular non-membrane-bounded organelle
GO:0016020	0.622	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]