StarFunc result for job id P14651

User Input

>input (431 residues)
MQKATYYDNAAAALFGGYSSYPGSNGFGFDVPPQPPFQAATHLEGDYQRSACSLQSLGNA
APHAKSKELNGSCMRPGLAPEPLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPG
TNSTLTKQIFPWMKESRQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDK
SPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRR
MKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYESPSPPAFGKAHQN
AYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYAD
PLPPPAGPSLYGLNHLSHHPSGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQG
RIQEAPKLTHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RA33	0.202	0.198	4.027E-26	443	0.552	0.537	A0A024RA33.pdb.gz
2	AFDB:P09027	0.213	0.212	2.338E-25	433	0.527	0.524	P09027.pdb.gz	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
3	AFDB:Q8AWZ2	0.209	0.218	2.669E-24	410	0.499	0.524	Q8AWZ2.pdb.gz	HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio OX=7955 GN=hoxa3a PE=2 SV=1
4	AFDB:A0JPE5	0.152	0.206	6.110E-5	309	0.118	0.165	A0JPE5.pdb.gz	A0JPE5_DANRE Mix-type homeobox gene 1 OS=Danio rerio OX=7955 GN=mtx1 PE=2 SV=1
5	AFDB:P10105	0.157	0.111	6.996E-5	635	0.227	0.154	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
6	AFDB:Q10328	0.146	0.072	1.376E-4	942	0.174	0.080	Q10328.pdb.gz	PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phx1 PE=3 SV=1
7	AFDB:Q9U2Z0	0.184	0.199	2.529E-4	391	0.176	0.194	Q9U2Z0.pdb.gz	OTXH_CAEEL Homeobox protein ttx-1 OS=Caenorhabditis elegans OX=6239 GN=ttx-1 PE=1 SV=2
8	AFDB:D3ZRI4	0.134	0.113	2.203E-3	515	0.169	0.142	D3ZRI4.pdb.gz	D3ZRI4_RAT Iroquois homeobox 4 OS=Rattus norvegicus OX=10116 GN=Irx4 PE=3 SV=1
9	PDB:4egcA	0.115	0.092	3.856E-2	539	0.028	0.022	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
10	PDB:2hi3A	0.124	0.630	7.088E-2	73	0.032	0.192	2hi3A.pdb.gz
11	AFDB:Q76IQ7	0.082	0.076	1.114E-1	473	0.158	0.144	Q76IQ7.pdb.gz	TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus OX=10116 GN=Tox2 PE=2 SV=1
12	AFDB:F1NPG5	0.074	0.051	2.509E-1	639	0.151	0.102	F1NPG5.pdb.gz	CENPT_CHICK Centromere protein T OS=Gallus gallus OX=9031 GN=CENPT PE=1 SV=2
13	PDB:7fbyA	0.093	0.231	9.913E-1	153	0.016	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.091	0.309	1.822	113	0.016	0.062	5nr5A.pdb.gz
15	PDB:2cg4A	0.079	0.212	2.086	149	0.021	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:5aj0BZ	0.097	0.407	2.232	86	0.026	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:2h09A	0.077	0.229	2.926	127	0.021	0.071	2h09A.pdb.gz
18	PDB:5gadi	0.104	0.101	2.926	450	0.046	0.044	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
19	PDB:1ea4F	0.054	0.323	3.131	45	0.032	0.311	1ea4F.pdb.gz	Plasmid Transcriptional Repressor Copg Oligomerises to Render Helical Superstructures Unbound and in Complexes with Oligonucleotides
20	PDB:7awtE	0.063	0.145	3.350	156	0.021	0.058	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09026	0.0	723	433	0.951	0.947	HXB3_MOUSE Homeobox protein Hox-B3 OS=Mus musculus OX=10090 GN=Hoxb3 PE=2 SV=4
2	P14651	0.0	854	431	1.000	1.000	HXB3_HUMAN Homeobox protein Hox-B3 OS=Homo sapiens OX=9606 GN=HOXB3 PE=2 SV=2
3	O43365	6.95e-118	353	443	0.550	0.535	HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens OX=9606 GN=HOXA3 PE=1 SV=1
4	P31249	7.09e-115	345	432	0.524	0.523	HXD3_HUMAN Homeobox protein Hox-D3 OS=Homo sapiens OX=9606 GN=HOXD3 PE=1 SV=3
5	P09027	1.43e-113	342	433	0.527	0.524	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
6	Q8AWZ2	2.17e-106	322	410	0.499	0.524	HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio OX=7955 GN=hoxa3a PE=2 SV=1
7	P02831	6.35e-97	299	443	0.418	0.406	HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2
8	P14652	5.92e-31	124	356	0.135	0.163	HXB2_HUMAN Homeobox protein Hox-B2 OS=Homo sapiens OX=9606 GN=HOXB2 PE=1 SV=1
9	P0C1T1	1.08e-30	123	354	0.137	0.167	HXB2_MOUSE Homeobox protein Hox-B2 OS=Mus musculus OX=10090 GN=Hoxb2 PE=2 SV=1
10	P09013	2.12e-28	115	276	0.114	0.178	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
11	P09014	3.81e-28	114	275	0.114	0.178	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
12	P09067	4.09e-28	114	269	0.114	0.182	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
13	P09079	4.09e-28	114	269	0.114	0.182	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
14	P20719	4.40e-28	114	270	0.114	0.181	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
15	P09021	5.02e-28	114	270	0.114	0.181	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
16	O43364	7.61e-28	115	376	0.118	0.136	HXA2_HUMAN Homeobox protein Hox-A2 OS=Homo sapiens OX=9606 GN=HOXA2 PE=1 SV=1
17	P31246	8.30e-28	115	372	0.118	0.137	HXA2_RAT Homeobox protein Hox-A2 OS=Rattus norvegicus OX=10116 GN=Hoxa2 PE=2 SV=1
18	P31245	9.08e-28	115	372	0.118	0.137	HXA2_MOUSE Homeobox protein Hox-A2 OS=Mus musculus OX=10090 GN=Hoxa2 PE=2 SV=1
19	O57374	4.55e-27	110	236	0.116	0.212	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
20	P06798	1.03e-26	110	285	0.118	0.179	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13293 DUF4074	4.5e-29	111.7	Domain of unknown function (DUF4074)
2	PF05920 Homeobox_KN	6.2e+02	11.7	Homeobox KN domain
3	PF00046 Homeodomain	5.9e-18	75.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.668	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000404658	0.630	Histone-lysine N-methyltransferase EZH1
3	9606.ENSP00000328928	0.583	Homeobox protein Hox-B4
4	9606.ENSP00000272369	0.564	Homeobox protein Meis1
5	9606.ENSP00000453793	0.563	Homeobox protein Meis2
6	9606.ENSP00000331741	0.559	Homeobox protein Hox-B2
7	9606.ENSP00000239151	0.523	Homeobox protein Hox-B5
8	9606.ENSP00000451594	0.520	Modulator of apoptosis 1
9	9606.ENSP00000362588	0.507	Pre-B-cell leukemia transcription factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.980	protein binding
GO:0000978	0.869	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009889	0.992	regulation of biosynthetic process
GO:0019219	0.990	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0032502	0.985	developmental process
GO:0048856	0.980	anatomical structure development
GO:0032501	0.964	multicellular organismal process
GO:0010556	0.945	regulation of macromolecule biosynthetic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0007275	0.944	multicellular organism development
GO:0006357	0.937	regulation of transcription by RNA polymerase II
GO:0048522	0.928	positive regulation of cellular process
GO:0009893	0.876	positive regulation of metabolic process
GO:0051173	0.865	positive regulation of nitrogen compound metabolic process
GO:0031325	0.865	positive regulation of cellular metabolic process
GO:0009987	0.836	cellular process
GO:0010604	0.827	positive regulation of macromolecule metabolic process
GO:0045935	0.794	positive regulation of nucleobase-containing compound metabolic process
GO:0048731	0.793	system development
GO:0009891	0.773	positive regulation of biosynthetic process
GO:0009653	0.772	anatomical structure morphogenesis
GO:0045893	0.689	positive regulation of DNA-templated transcription
GO:0035239	0.657	tube morphogenesis
GO:0045944	0.589	positive regulation of transcription by RNA polymerase II
GO:0072359	0.580	circulatory system development
GO:0048646	0.579	anatomical structure formation involved in morphogenesis
GO:0001568	0.534	blood vessel development
GO:0048523	0.395	negative regulation of cellular process
GO:0048513	0.356	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.498	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]